Western Blot (WB)
(WB Suggested Anti-PDGFRL AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Rabbit PDGFRL Polyclonal Antibody | anti-PDGFRL antibody
PDGFRL Antibody - N-terminal region
Gene Names
PDGFRL; PDGRL; PRLTS
Reactivity
Cow, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDGFRL; Polyclonal Antibody; PDGFRL Antibody - N-terminal region; anti-PDGFRL antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVE
Sequence Length
375
Applicable Applications for anti-PDGFRL antibody
Western Blot (WB)
Homology
Cow: 75%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PDGFRL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PDGFRL AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-PDGFRL AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Related Product Information for anti-PDGFRL antibody
This is a rabbit polyclonal antibody against PDGFRL. It was validated on Western Blot
Target Description: This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor.
Target Description: This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor.
Product Categories/Family for anti-PDGFRL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
platelet-derived growth factor receptor-like protein
NCBI Official Synonym Full Names
platelet derived growth factor receptor like
NCBI Official Symbol
PDGFRL
NCBI Official Synonym Symbols
PDGRL; PRLTS
NCBI Protein Information
platelet-derived growth factor receptor-like protein
UniProt Protein Name
Platelet-derived growth factor receptor-like protein
Protein Family
UniProt Gene Name
PDGFRL
UniProt Synonym Gene Names
PRLTS; PDGFR-like protein
UniProt Entry Name
PGFRL_HUMAN
NCBI Description
This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor. [provided by RefSeq, Jul 2008]
Uniprot Description
PDGFRL: Defects in PDGFRL are associated with colorectal cancer (CRC).
Protein type: Secreted; Receptor, misc.; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 8p22-p21.3
Cellular Component: extracellular region
Molecular Function: platelet activating factor receptor activity; platelet-derived growth factor beta-receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Disease: Hepatocellular Carcinoma
Research Articles on PDGFRL
Similar Products
Product Notes
The PDGFRL pdgfrl (Catalog #AAA3217035) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDGFRL Antibody - N-terminal region reacts with Cow, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFRL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDGFRL pdgfrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVKPKIPKMK DRDSANSAPK TQSIMMQVLD KGRFQKPAAT LSLLAGQTVE. It is sometimes possible for the material contained within the vial of "PDGFRL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
