Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LAMC3 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellLAMC3 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit LAMC3 Polyclonal Antibody | anti-LAMC3 antibody

LAMC3 Antibody - C-terminal region

Gene Names
LAMC3; OCCM
Reactivity
Cow, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LAMC3; Polyclonal Antibody; LAMC3 Antibody - C-terminal region; anti-LAMC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT
Sequence Length
1379
Applicable Applications for anti-LAMC3 antibody
Western Blot (WB)
Homology
Cow: 92%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAMC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LAMC3 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellLAMC3 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-LAMC3 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellLAMC3 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-LAMC3 antibody
This is a rabbit polyclonal antibody against LAMC3. It was validated on Western Blot

Target Description: Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene.
Product Categories/Family for anti-LAMC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
laminin, gamma 3 variant, partial
NCBI Official Synonym Full Names
laminin subunit gamma 3
NCBI Official Symbol
LAMC3
NCBI Official Synonym Symbols
OCCM
NCBI Protein Information
laminin subunit gamma-3
UniProt Protein Name
Laminin subunit gamma-3
Protein Family
UniProt Gene Name
LAMC3
UniProt Entry Name
LAMC3_HUMAN

NCBI Description

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 3. The gamma 3 chain is most similar to the gamma 1 chain, and contains all the 6 domains expected of the gamma chain. It is a component of laminin 12. The gamma 3 chain is broadly expressed in skin, heart, lung, and the reproductive tracts. In skin, it is seen within the basement membrane of the dermal-epidermal junction at points of nerve penetration. Gamma 3 is also a prominent element of the apical surface of ciliated epithelial cells of lung, oviduct, epididymis, ductus deferens, and seminiferous tubules. The distribution of gamma 3-containing laminins along ciliated epithelial surfaces suggests that the apical laminins are important in the morphogenesis and structural stability of the ciliated processes of these cells. [provided by RefSeq, Aug 2011]

Uniprot Description

LAMC3: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Defects in LAMC3 are the cause of cortical malformations occipital (OCCM). OCCM is a disease in which affected individuals develop seizures, sometimes associated with transient visual changes. Brain MRI shows both pachygyria and polymicrogyria restricted to the lateral occipital lobes.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Extracellular matrix; Secreted

Chromosomal Location of Human Ortholog: 9q34.12

Cellular Component: proteinaceous extracellular matrix; membrane; extracellular region; basement membrane

Molecular Function: structural molecule activity

Biological Process: cellular morphogenesis during differentiation; extracellular matrix organization and biogenesis; visual perception; retina development in camera-type eye; cell adhesion; astrocyte development

Disease: Cortical Malformations, Occipital

Research Articles on LAMC3

Similar Products

Product Notes

The LAMC3 lamc3 (Catalog #AAA3216913) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAMC3 Antibody - C-terminal region reacts with Cow, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LAMC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LAMC3 lamc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERMLGNAAPL SSSAKKKGRE AEVLAKDSAK LAKALLRERK QAHRRASRLT. It is sometimes possible for the material contained within the vial of "LAMC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.