Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHIASample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse CHIA1 Polyclonal Antibody | anti-CHIA1 antibody

CHIA1 Antibody - middle region

Gene Names
Chia1; YNL; Chia; AMCase; 2200003E03Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHIA1; Polyclonal Antibody; CHIA1 Antibody - middle region; anti-CHIA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKH
Sequence Length
473
Applicable Applications for anti-CHIA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CHIA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHIASample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHIASample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-CHIA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
acidic mammalian chitinase
NCBI Official Synonym Full Names
chitinase, acidic 1
NCBI Official Symbol
Chia1
NCBI Official Synonym Symbols
YNL; Chia; AMCase; 2200003E03Rik
NCBI Protein Information
acidic mammalian chitinase
UniProt Protein Name
Acidic mammalian chitinase
Protein Family
UniProt Gene Name
Chia
UniProt Synonym Gene Names
Chia1; AMCase
UniProt Entry Name
CHIA_MOUSE

Uniprot Description

CHIA: Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding. Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; Secreted; Hydrolase; Secreted, signal peptide; EC 3.2.1.14

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: hydrolase activity; hydrolase activity, acting on glycosyl bonds; chitin binding; chitinase activity; kinase binding; hydrolase activity, hydrolyzing O-glycosyl compounds

Biological Process: polysaccharide catabolic process; apoptosis; metabolic process; production of molecular mediator of acute inflammatory response; immune system process; carbohydrate metabolic process; immune response; chitin catabolic process; inflammatory response; chitin metabolic process

Research Articles on CHIA1

Similar Products

Product Notes

The CHIA1 chia (Catalog #AAA3223545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHIA1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CHIA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHIA1 chia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APFTTMVSTS QNRQTFITSV IKFLRQYGFD GLDLDWEYPG SRGSPPQDKH. It is sometimes possible for the material contained within the vial of "CHIA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.