Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UBE2E1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellUBE2E1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit UBE2E1 Polyclonal Antibody | anti-UBE2E1 antibody

UBE2E1 antibody - N-terminal region

Gene Names
UBE2E1; UBCH6
Reactivity
Dog, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE2E1; Polyclonal Antibody; UBE2E1 antibody - N-terminal region; anti-UBE2E1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVY
Sequence Length
176
Applicable Applications for anti-UBE2E1 antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UBE2E1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellUBE2E1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-UBE2E1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellUBE2E1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-UBE2E1 antibody
This is a rabbit polyclonal antibody against UBE2E1. It was validated on Western Blot

Target Description: UBE2E1 catalyzes the covalent attachment of ubiquitin to other proteins. UBE2E1 mediates the selective degradation of short-lived and abnormal proteins.
Product Categories/Family for anti-UBE2E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 E1 isoform 2
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 E1
NCBI Official Symbol
UBE2E1
NCBI Official Synonym Symbols
UBCH6
NCBI Protein Information
ubiquitin-conjugating enzyme E2 E1
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 E1
UniProt Gene Name
UBE2E1
UniProt Synonym Gene Names
UBCH6
UniProt Entry Name
UB2E1_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

UBE2E1: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin ligase; Ligase; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p24.2

Cellular Component: nucleoplasm; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; ISG15 conjugating enzyme activity; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; ISG15-protein conjugation; histone monoubiquitination; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; cytokine and chemokine mediated signaling pathway; mitotic cell cycle spindle assembly checkpoint; histone H2B ubiquitination; protein ubiquitination; mitotic cell cycle

Research Articles on UBE2E1

Similar Products

Product Notes

The UBE2E1 ube2e1 (Catalog #AAA3206891) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2E1 antibody - N-terminal region reacts with Dog, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2E1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2E1 ube2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETNTPKKKES KVSMSKNSKL LSTSAKSAGP KGDNIYEWRS TILGPPGSVY. It is sometimes possible for the material contained within the vial of "UBE2E1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.