Rabbit anti-Human CLIP3 Polyclonal Antibody | anti-CLIP3 antibody

CLIP3 Antibody - middle region

Cat. Num. AAA3222233

• Gene Names: CLIP3; RSNL1; CLIPR59; CLIPR-59
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: CLIP3; Polyclonal Antibody; CLIP3 Antibody - middle region; anti-CLIP3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQR
• Sequence Length: 547

• Applicable Applications for anti-CLIP3 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLIP3
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CLIP3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-CLIP3 antibody

This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene.

Product Categories/Family for anti-CLIP3 antibody

Polyclonal; Lymphocyte Signaling; Immunology; Apoptosis; Membrane & Traffic; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 313851097
• NCBI GeneID: 25999
• NCBI Accession #: NP_001186499.1
• NCBI GenBank Nucleotide #: NM_001199570.1
• UniProt Accession #: Q96DZ5
• Molecular Weight: 60 kDa
• NCBI Official Full Name: CAP-Gly domain-containing linker protein 3
• NCBI Official Synonym Full Names: CAP-Gly domain containing linker protein 3
• NCBI Official Symbol: CLIP3
• NCBI Official Synonym Symbols: RSNL1; CLIPR59; CLIPR-59
• NCBI Protein Information: CAP-Gly domain-containing linker protein 3
• UniProt Protein Name: CAP-Gly domain-containing linker protein 3
• Protein Family: CAP-Gly domain-containing linker protein
• UniProt Gene Name: CLIP3
• UniProt Synonym Gene Names: CLIPR59; CLIP-170-related 59 kDa protein; CLIPR-59
• UniProt Entry Name: CLIP3_HUMAN

NCBI Description

This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

CLIPR-59: Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: Golgi stack; early endosome membrane; recycling endosome membrane; plasma membrane; trans-Golgi network membrane; trans-Golgi network; lipid raft

Molecular Function: microtubule binding

Biological Process: peptidyl-S-palmitoyl-L-cysteine biosynthetic process from peptidyl-cysteine; fat cell differentiation; positive regulation of apoptosis; negative regulation of microtubule polymerization; positive regulation of endocytosis; positive regulation of protein amino acid phosphorylation