Rabbit anti-Mouse ARG2 Polyclonal Antibody | anti-ARG2 antibody

ARG2 Antibody - middle region

Cat. Num. AAA3223669

• Gene Names: Arg2; AII; AU022422
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: ARG2; Polyclonal Antibody; ARG2 Antibody - middle region; anti-ARG2 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPN
• Sequence Length: 354

• Applicable Applications for anti-ARG2 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ARG2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARG2Sample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-ARG2 antibody

May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to nitric oxid synthase (NOS). Arginine metabolism is a critical regulator of innate and adaptive immune responses. Seems to be involved in negative regulation of the survival capacity of activated CD4+ and CD8+ T cells. May suppress inflammation-related signaling in asthmatic airway epithelium. May contribute to the immune evasion of H.pylori by restricting M1 macrophage activation and polyamine metabolism. May play a role in promoting prenatal immune suppression (By similarity). Regulates RPS6KB1 signaling, which promotes endothelial cell senescence and inflammation and implicates NOS3/eNOS dysfunction. Can inhibit endothelial autophagy independently of its enzymatic activity implicating mTORC2 signaling. Involved in vascular smooth muscle cell senescence and apoptosis independently of its enzymatic activity (By similarity).

Product Categories/Family for anti-ARG2 antibody

Polyclonal; Signaling Intermediate; Immunology; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 6753110
• NCBI GeneID: 11847
• NCBI Accession #: NP_033835.1
• NCBI GenBank Nucleotide #: NM_009705.3
• UniProt Accession #: O08691
• Molecular Weight: 38 kDa
• NCBI Official Full Name: arginase-2, mitochondrial
• NCBI Official Synonym Full Names: arginase type II
• NCBI Official Symbol: Arg2
• NCBI Official Synonym Symbols: AII; AU022422
• NCBI Protein Information: arginase-2, mitochondrial
• UniProt Protein Name: Arginase-2, mitochondrial
• Protein Family: Arginase
• UniProt Gene Name: Arg2
• UniProt Entry Name: ARGI2_MOUSE

Uniprot Description

ARG2: May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase. Since NO synthase is found in the penile corpus cavernosum smooth muscle, the clitoral corpus cavernosum and the vagina, arginase II plays a role in both male and female sexual arousal. It is therefore a potential target for the treatment of male and female sexual arousal disorders. Belongs to the arginase family.

Protein type: EC 3.5.3.1; Mitochondrial; Amino Acid Metabolism - arginine and proline; Hydrolase

Cellular Component: mitochondrion

Molecular Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines; hydrolase activity; metal ion binding; arginase activity; nitric-oxide synthase binding

Biological Process: striated muscle contraction; negative regulation of nitric-oxide synthase activity; arginine metabolic process; arginine catabolic process to ornithine; negative regulation of striated muscle contraction; urea cycle