Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of HeLa cells, using CHD7 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)

Rabbit anti-Human CHD7 Polyclonal Antibody | anti-CHD7 antibody

CHD7 Rabbit pAb

Gene Names
CHD7; CRG; HH5; IS3; KAL5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
CHD7; Polyclonal Antibody; CHD7 Rabbit pAb; CRG; HH5; IS3; KAL5; anti-CHD7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMMSNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQGHPQHMQQMGSYMARGDFSMQQHGQPQQRMSQFSQGQEGLNQGNPFIATSGPGHLSHVPQQSPSMAPSLRHSVQQFHHHPSTALHGESVAHSPRFSPNPPQQGAVRPQTLNFSSRSQTVP
Applicable Applications for anti-CHD7 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CHD7 (NP_060250.2).
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of HeLa cells, using CHD7 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)

Western Blot (WB) (Western blot analysis of extracts of HeLa cells, using CHD7 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)
Related Product Information for anti-CHD7 antibody
Background: This gene encodes a protein that contains several helicase family domains. Mutations in this gene have been found in some patients with the CHARGE syndrome. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,085 Da
NCBI Official Full Name
chromodomain-helicase-DNA-binding protein 7
NCBI Official Synonym Full Names
chromodomain helicase DNA binding protein 7
NCBI Official Symbol
CHD7
NCBI Official Synonym Symbols
CRG; HH5; IS3; KAL5
NCBI Protein Information
chromodomain-helicase-DNA-binding protein 7; CHARGE association; ATP-dependent helicase CHD7; chromodomain helicase DNA binding protein 7 isoform CRA_e
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 7
UniProt Gene Name
CHD7
UniProt Synonym Gene Names
KIAA1416; CHD-7
UniProt Entry Name
CHD7_HUMAN

NCBI Description

This gene encodes a protein that contains several helicase family domains. Mutations in this gene have been found in some patients with the CHARGE syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

CHD-7: Probable transcription regulator. May interact with CTCF. Interacts with CHD8. Widely expressed in fetal and adult tissues. Belongs to the SNF2/RAD54 helicase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; DNA-binding; EC 3.6.4.12; Helicase

Chromosomal Location of Human Ortholog: 8q12.2

Cellular Component: nucleoplasm; nucleolus; nucleus

Molecular Function: protein binding; DNA binding; chromatin binding; helicase activity; ATP binding

Biological Process: limb development; heart morphogenesis; central nervous system development; olfactory behavior; blood circulation; positive regulation of multicellular organism growth; palate development; female genitalia development; regulation of growth hormone secretion; olfactory nerve development; embryonic hindlimb morphogenesis; adult walking behavior; sensory perception of sound; regulation of neurogenesis; regulation of transcription, DNA-dependent; skeletal development; T cell differentiation; adult heart development; inner ear morphogenesis; transcription, DNA-dependent; in utero embryonic development; olfactory bulb development; semicircular canal morphogenesis; cranial nerve development; chromatin modification; genitalia development; retina development in camera-type eye; artery morphogenesis; cognition; nose development; rRNA processing

Disease: Charge Syndrome; Tracheoesophageal Fistula With Or Without Esophageal Atresia; Hypogonadotropic Hypogonadism 5 With Or Without Anosmia

Research Articles on CHD7

Similar Products

Product Notes

The CHD7 chd7 (Catalog #AAA9142648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHD7 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHD7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CHD7 chd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADPGMMSLF GEDGNIFSEG LEGLGECGYP ENPVNPMGQQ MPIDQGFASL QPSLHHPSTN QNQTKLTHFD HYNQYEQQKM HLMDQPNRMM SNTPGNGLAS PHSQYHTPPV PQVPHGGSGG GQMGVYPGMQ NERHGQSFVD SSSMWGPRAV QVPDQIRAPY QQQQPQPQPP QPAPSGPPAQ GHPQHMQQMG SYMARGDFSM QQHGQPQQRM SQFSQGQEGL NQGNPFIATS GPGHLSHVPQ QSPSMAPSLR HSVQQFHHHP STALHGESVA HSPRFSPNPP QQGAVRPQTL NFSSRSQTVP. It is sometimes possible for the material contained within the vial of "CHD7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.