Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CENTG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit CENTG1 Polyclonal Antibody | anti-AGAP2 antibody

CENTG1 antibody - middle region

Gene Names
AGAP2; PIKE; GGAP2; CENTG1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CENTG1; Polyclonal Antibody; CENTG1 antibody - middle region; anti-AGAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG
Sequence Length
836
Applicable Applications for anti-AGAP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CENTG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CENTG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CENTG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-AGAP2 antibody
This is a rabbit polyclonal antibody against CENTG1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.
Product Categories/Family for anti-AGAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 isoform PIKE-A
NCBI Official Synonym Full Names
ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
NCBI Official Symbol
AGAP2
NCBI Official Synonym Symbols
PIKE; GGAP2; CENTG1
NCBI Protein Information
arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
UniProt Protein Name
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
UniProt Gene Name
AGAP2
UniProt Synonym Gene Names
CENTG1; KIAA0167; AGAP-2; Cnt-g1; GGAP2; PIKE
UniProt Entry Name
AGAP2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the centaurin gamma-like family. It mediates anti-apoptotic effects of nerve growth factor by activating nuclear phosphoinositide 3-kinase. It is overexpressed in cancer cells, and promotes cancer cell invasion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

CENTG1: a member of the centaurin family of ADP-ribosylation factor directed GTPase-activating proteins (GAPs). A GAP for ARF1 and ARF5. Two alternatively-spliced isoforms have been described. Isoform 1 is brain-specific, and isoform 2 is ubiquitously expressed, with highest levels in brain and heart. Isoform 1 participates to the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. Regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. The PH domains of isoforms 1 and 2 bind phospholipids, but they differentially regulate subcellular location. The PH domain of isoform 1 directs the protein to the nucleus, but the PH domain of isoform 2 directs it to the cytosol.

Protein type: Motility/polarity/chemotaxis; GAPs; GAPs, ARF; Tumor suppressor

Chromosomal Location of Human Ortholog: 12q14.1

Cellular Component: membrane; mitochondrion; nucleolus; nucleus

Molecular Function: protein binding; GTP binding; zinc ion binding

Biological Process: axon guidance; protein transport; small GTPase mediated signal transduction; negative regulation of neuron apoptosis; negative regulation of protein catabolic process; positive regulation of GTPase activity

Research Articles on AGAP2

Similar Products

Product Notes

The AGAP2 agap2 (Catalog #AAA3210747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CENTG1 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CENTG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGAP2 agap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHARHGPLDT SVEDPQLRSP LHLAAELAHV VITQLLLWYG ADVAARDAQG. It is sometimes possible for the material contained within the vial of "CENTG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.