Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CDC40 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCDC40 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit CDC40 Polyclonal Antibody | anti-CDC40 antibody

CDC40 antibody - N-terminal region

Gene Names
CDC40; EHB3; PRP17; PRPF17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDC40; Polyclonal Antibody; CDC40 antibody - N-terminal region; anti-CDC40 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEE
Sequence Length
579
Applicable Applications for anti-CDC40 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CDC40 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCDC40 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-CDC40 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCDC40 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-CDC40 antibody
This is a rabbit polyclonal antibody against CDC40. It was validated on Western Blot

Target Description: Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression.
Product Categories/Family for anti-CDC40 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
pre-mRNA-processing factor 17
NCBI Official Synonym Full Names
cell division cycle 40
NCBI Official Symbol
CDC40
NCBI Official Synonym Symbols
EHB3; PRP17; PRPF17
NCBI Protein Information
pre-mRNA-processing factor 17
UniProt Protein Name
Pre-mRNA-processing factor 17
UniProt Gene Name
CDC40
UniProt Synonym Gene Names
EHB3; PRP17; PRPF17; Ehb3; hPRP17
UniProt Entry Name
PRP17_HUMAN

NCBI Description

Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq, Jul 2008]

Uniprot Description

CDC40: Associates with the spliceosome late in the splicing pathway and may function in the second step of pre-mRNA splicing.

Protein type: RNA splicing; Spliceosome; Motility/polarity/chemotaxis; RNA processing

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: nucleoplasm; spliceosome

Molecular Function: protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; mRNA export from nucleus; RNA splicing; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Research Articles on CDC40

Similar Products

Product Notes

The CDC40 cdc40 (Catalog #AAA3216433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC40 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDC40 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC40 cdc40 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NQGLTVFETG QKKTEKRKKF KENDASNIDG FLGPWAKYVD EKDVAKPSEE. It is sometimes possible for the material contained within the vial of "CDC40, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.