Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CD58 Polyclonal Antibody | anti-CD58 antibody

CD58 (Lymphocyte Function-associated Antigen 3, Ag3, Surface Glycoprotein LFA-3, LFA3) (MaxLight 750)

Gene Names
CD58; ag3; LFA3; LFA-3; FLJ23181; FLJ43722
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD58; Polyclonal Antibody; CD58 (Lymphocyte Function-associated Antigen 3; Ag3; Surface Glycoprotein LFA-3; LFA3) (MaxLight 750); anti-CD58 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD58.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CD58 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD58, aa1-250 (NP_001770.1).
Immunogen Sequence
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CD58 antibody
CD58, or LFA-3, is a membrane glycoprotein of 55-70kD. It occurs in two forms, one transmembrane with a cytoplasmic domain, the other form anchored in the membrane via a glycosylphosphatidylinositol tail. The complete amino acid sequence of both forms has been deduced from cDNA. It is heavily N-glycosylated. CD58 is a cell adhesion molecule which plays a critical role in facilitation of antigen specific recognition through interaction with CD2 on T lymphocytes. It is a member of the immunoglobulin superfamily of molecules.CD58 has a wide tissue distribution, being present on erythrocytes, platelets, monocytes, a subset of lymphocytes, bone marrow cells, epithelium and endothelial cells[2]. There are approximately 5,000 CD58 molecules on each erythrocyte. There is reduced expression of CD58 on haemopoietic cells in individuals with paroxysmal nocturnal haemoglobinuria.
Product Categories/Family for anti-CD58 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
965
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,147 Da
NCBI Official Full Name
lymphocyte function-associated antigen 3 isoform 1
NCBI Official Synonym Full Names
CD58 molecule
NCBI Official Symbol
CD58
NCBI Official Synonym Symbols
ag3; LFA3; LFA-3; FLJ23181; FLJ43722
NCBI Protein Information
lymphocyte function-associated antigen 3; OTTHUMP00000024363; OTTHUMP00000024364; OTTHUMP00000231922; OTTHUMP00000231923; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3)
UniProt Protein Name
Lymphocyte function-associated antigen 3
UniProt Gene Name
CD58
UniProt Synonym Gene Names
LFA3; Ag3
UniProt Entry Name
LFA3_HUMAN

Uniprot Description

CD58: Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen- presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: cell surface; membrane; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; receptor binding

Biological Process: heterotypic cell-cell adhesion; cell-cell adhesion; cell adhesion; blood coagulation; leukocyte migration

Similar Products

Product Notes

The CD58 cd58 (Catalog #AAA6373178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD58 (Lymphocyte Function-associated Antigen 3, Ag3, Surface Glycoprotein LFA-3, LFA3) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD58 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD58 cd58 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD58, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.