Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

CD58 recombinant protein

CD58 Recombinant Protein

Gene Names
CD58; ag3; LFA3; LFA-3
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Synonyms
CD58; CD58 Recombinant Protein; CD58 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Restriction Site
NdeI-XhoI
Expression Vector
pet-22b(+)
Preparation and Storage
Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.

Testing Data

Testing Data
Related Product Information for CD58 recombinant protein
CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellular domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
965
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,147 Da
NCBI Official Full Name
lymphocyte function-associated antigen 3 isoform 2
NCBI Official Synonym Full Names
CD58 molecule
NCBI Official Symbol
CD58
NCBI Official Synonym Symbols
ag3; LFA3; LFA-3
NCBI Protein Information
lymphocyte function-associated antigen 3; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3)
UniProt Protein Name
Lymphocyte function-associated antigen 3
UniProt Gene Name
CD58
UniProt Synonym Gene Names
LFA3; Ag3
UniProt Entry Name
LFA3_HUMAN

NCBI Description

This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]

Uniprot Description

CD58: Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen- presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: cell surface; membrane; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; receptor binding

Biological Process: heterotypic cell-cell adhesion; cell-cell adhesion; cell adhesion; blood coagulation; leukocyte migration

Research Articles on CD58

Similar Products

Product Notes

The CD58 cd58 (Catalog #AAA3016003) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FSQQIYGVVY GNVTFHVPSN VPLKEVLWKK QKDKVAELEN SEFRAFSSFK NRVYLDTVSG SLTIYNLTSS DEDEYEMESP NITDTMKFFL YVLESLPSPT LTCALTNGSI EVQCMIPEHY NSHRGLIMYS WDCPMEQCKR NSTSIYFKME NDLPQKIQCT LSNPLFNTTS SIILTTCIPS SGHSRHR. It is sometimes possible for the material contained within the vial of "CD58, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.