Rabbit anti-Human CD58 Polyclonal Antibody | anti-CD58 antibody

CD58 (Lymphocyte Function-associated Antigen 3, Ag3, Surface Glycoprotein LFA-3, LFA3) (AP)

Cat. Num. AAA6373169

• Gene Names: CD58; ag3; LFA3; LFA-3; FLJ23181; FLJ43722
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD58; Polyclonal Antibody; CD58 (Lymphocyte Function-associated Antigen 3; Ag3; Surface Glycoprotein LFA-3; LFA3) (AP); anti-CD58 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CD58.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CD58 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CD58, aa1-250 (NP_001770.1).
• Immunogen Sequence: MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD58 expression in transfected 293T cell line by CD58 polyclonal antibody. Lane 1: CD58 transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CD58 antibody

CD58, or LFA-3, is a membrane glycoprotein of 55-70kD. It occurs in two forms, one transmembrane with a cytoplasmic domain, the other form anchored in the membrane via a glycosylphosphatidylinositol tail. The complete amino acid sequence of both forms has been deduced from cDNA. It is heavily N-glycosylated. CD58 is a cell adhesion molecule which plays a critical role in facilitation of antigen specific recognition through interaction with CD2 on T lymphocytes. It is a member of the immunoglobulin superfamily of molecules.CD58 has a wide tissue distribution, being present on erythrocytes, platelets, monocytes, a subset of lymphocytes, bone marrow cells, epithelium and endothelial cells[2]. There are approximately 5,000 CD58 molecules on each erythrocyte. There is reduced expression of CD58 on haemopoietic cells in individuals with paroxysmal nocturnal haemoglobinuria.

Product Categories/Family for anti-CD58 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4502677
• NCBI GeneID: 965
• NCBI Accession #: NP_001770.1
• NCBI GenBank Nucleotide #: NM_001779.1
• UniProt Accession #: P19256; Q5U053; Q6IB65; Q96KI9; A8K7G5; Q14748; Q16393; Q9BRW0
• Molecular Weight: 28,147 Da
• NCBI Official Full Name: lymphocyte function-associated antigen 3 isoform 1
• NCBI Official Synonym Full Names: CD58 molecule
• NCBI Official Symbol: CD58
• NCBI Official Synonym Symbols: ag3; LFA3; LFA-3; FLJ23181; FLJ43722
• NCBI Protein Information: lymphocyte function-associated antigen 3; OTTHUMP00000024363; OTTHUMP00000024364; OTTHUMP00000231922; OTTHUMP00000231923; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3)
• UniProt Protein Name: Lymphocyte function-associated antigen 3
• Protein Family: Lymphocyte function-associated antigen
• UniProt Gene Name: CD58
• UniProt Synonym Gene Names: LFA3; Ag3
• UniProt Entry Name: LFA3_HUMAN

Uniprot Description

CD58: Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen- presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: cell surface; membrane; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; receptor binding

Biological Process: heterotypic cell-cell adhesion; cell-cell adhesion; cell adhesion; blood coagulation; leukocyte migration