SDS-PAGE
Angiogenin-1 Recombinant Protein | ANG1 recombinant protein
Recombinant Bovine Angiogenin-1
Gene Names
ANG; ANG1; RAA1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Angiogenin-1; Recombinant Bovine Angiogenin-1; ANG1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-148aa; Full Length
Sequence
AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH
Sequence Length
148
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for ANG1 recombinant protein
Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity.
References
Cloning, sequencing, and expression of bovine angiogenin.Chang S.-I. The complete amino acid sequence of bovine milk angiogenin.Maes P., Damart D., Rommens C., Montreuil J., Spik G., Tartar A.FEBS Lett. 241:41-45(1988)
Amino acid sequence of bovine angiogenin.Bond M.D., Strydom D.J.Biochemistry 28:6110-6113(1989)
Isolation of bovine angiogenin using a placental ribonuclease inhibitor binding assay.Bond M.D., Vallee B.L.Biochemistry 27:6282-6287(1988)
Crystal structure of bovine angiogenin at 1.5-A resolution.Acharya K.R., Shapiro R., Riordan J.F., Vallee B.L.Proc. Natl. Acad. Sci. U.S.A. 92:2949-2953(1995)
Solution structure of bovine angiogenin by 1H nuclear magnetic resonance spectroscopy.Lequin O., Albaret C., Bontems F., Spik G., Lallemand J.-Y.Biochemistry 35:8870-8880(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
18.6 kDa
NCBI Official Full Name
Angiogenin-1
NCBI Official Symbol
ANG
NCBI Official Synonym Symbols
ANG1; RAA1
NCBI Protein Information
angiogenin-1
UniProt Protein Name
Angiogenin-1
Protein Family
UniProt Gene Name
ANG1
UniProt Synonym Gene Names
ANG
UniProt Entry Name
ANG1_BOVIN
Uniprot Description
Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs) (). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity.
Research Articles on ANG1
Similar Products
Product Notes
The ANG1 ang1 (Catalog #AAA1265303) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-148aa; Full Length. The amino acid sequence is listed below: AQDDYRYIHF LTQHYDAKPK GRNDEYCFNM MKNRRLTRPC KDRNTFIHGN KNDIKAICED RNGQPYRGDL RISKSEFQIT ICKHKGGSSR PPCRYGATED SRVIVVGCEN GLPVHFDESF ITPRH. It is sometimes possible for the material contained within the vial of "Angiogenin-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
