Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCNE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateCCNE2 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit CCNE2 Polyclonal Antibody | anti-CCNE2 antibody

CCNE2 antibody - N-terminal region

Gene Names
CCNE2; CYCE2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCNE2; Polyclonal Antibody; CCNE2 antibody - N-terminal region; anti-CCNE2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDF
Sequence Length
404
Applicable Applications for anti-CCNE2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 84%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 92%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNE2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCNE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateCCNE2 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-CCNE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateCCNE2 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-CCNE2 antibody
This is a rabbit polyclonal antibody against CCNE2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
Product Categories/Family for anti-CCNE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
G1/S-specific cyclin-E2
NCBI Official Synonym Full Names
cyclin E2
NCBI Official Symbol
CCNE2
NCBI Official Synonym Symbols
CYCE2
NCBI Protein Information
G1/S-specific cyclin-E2
UniProt Protein Name
G1/S-specific cyclin-E2
Protein Family
UniProt Gene Name
CCNE2
UniProt Entry Name
CCNE2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2. This cyclin has been shown to specifically interact with CIP/KIP family of CDK inhibitors, and plays a role in cell cycle G1/S transition. The expression of this gene peaks at the G1-S phase and exhibits a pattern of tissue specificity distinct from that of cyclin E1. A significantly increased expression level of this gene was observed in tumor-derived cells. [provided by RefSeq, Jul 2008]

Uniprot Description

CCNE2: Essential for the control of the cell cycle at the late G1 and early S phase. Interacts with the CDK2 (in vivo) and CDK3 (in vitro) protein kinases to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex. Activated by papilloma viral oncoproteins E6 and E7 which bind to and inactivate p53 and Rb, respectively. According to PubMed:9858585, highest levels of expression in adult testis, thymus and brain. Lower levels in placenta, spleen and colon. Consistently elevated levels in tumor- derived cells compared to non-transformed proliferating cells. According to PubMed:9840927: low levels in thymus, prostate, brain, skeletal muscle, and kidney. Elevated levels in lung. According to PubMed:9840943 highly expressed in testis, placenta, thymus and brain. In a lesser extent in small intestine and colon. Belongs to the cyclin family. Cyclin E subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Activator

Chromosomal Location of Human Ortholog: 8q22.1

Cellular Component: nucleoplasm; cytosol

Molecular Function: protein binding; cyclin-dependent protein kinase regulator activity

Biological Process: DNA replication initiation; cell division; mitotic cell cycle; regulation of cyclin-dependent protein kinase activity; cell cycle checkpoint; G1/S transition of mitotic cell cycle

Research Articles on CCNE2

Similar Products

Product Notes

The CCNE2 ccne2 (Catalog #AAA3224391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNE2 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCNE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCNE2 ccne2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTQDVKKRRE EVTKKHQYEI RNCWPPVLSG GISPCIIIET PHKEIGTSDF. It is sometimes possible for the material contained within the vial of "CCNE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.