Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit CBLN4 Polyclonal Antibody | anti-CBLN4 antibody

CBLN4 antibody - C-terminal region

Gene Names
CBLN4; CBLNL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CBLN4; Polyclonal Antibody; CBLN4 antibody - C-terminal region; anti-CBLN4 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK
Sequence Length
201
Applicable Applications for anti-CBLN4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CBLN4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human cortex)

Immunohistochemistry (IHC)

(Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0ug/ml using anti-CBLN4 antibody )

Western Blot (WB)

(WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

Related Product Information for anti-CBLN4 antibody
This is a rabbit polyclonal antibody against CBLN4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. The protein encoded by this gene is a glycoprotein which shares sequence similarity with precerebellin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
cerebellin-4
NCBI Official Synonym Full Names
cerebellin 4 precursor
NCBI Official Symbol
CBLN4
NCBI Official Synonym Symbols
CBLNL1
NCBI Protein Information
cerebellin-4
UniProt Protein Name
Cerebellin-4
Protein Family
UniProt Gene Name
CBLN4
UniProt Synonym Gene Names
CBLNL1
UniProt Entry Name
CBLN4_HUMAN

NCBI Description

This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. [provided by RefSeq, Aug 2012]

Uniprot Description

CBLN4: May be involved in synaptic functions in the CNS. Can enable ER export and secretion of CBLN3.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: extracellular space; synapse; cell junction

Biological Process: protein secretion

Similar Products

Product Notes

The CBLN4 cbln4 (Catalog #AAA3210818) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBLN4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CBLN4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CBLN4 cbln4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HVIKVYQSQT IQVNLMLNGK PVISAFAGDK DVTREAATNG VLLYLDKEDK. It is sometimes possible for the material contained within the vial of "CBLN4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual