Rabbit CBLN4 Polyclonal Antibody | anti-CBLN4 antibody

CBLN4 antibody - C-terminal region

Cat. Num. AAA3210818

• Gene Names: CBLN4; CBLNL1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: CBLN4; Polyclonal Antibody; CBLN4 antibody - C-terminal region; anti-CBLN4 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK
• Sequence Length: 201

• Applicable Applications for anti-CBLN4 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CBLN4
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human cortex)

Immunohistochemistry (IHC)

(Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0ug/ml using anti-CBLN4 antibody )

Western Blot (WB)

(WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

Related Product Information for anti-CBLN4 antibody

This is a rabbit polyclonal antibody against CBLN4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. The protein encoded by this gene is a glycoprotein which shares sequence similarity with precerebellin.

Product Categories/Family for anti-CBLN4 antibody

Polyclonal; Signal Proteins; Lymphocyte Signaling; Membrane Protein; Developmental Biology; Immunohistochemistry; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 18104944
• NCBI GeneID: 140689
• NCBI Accession #: NP_542184
• NCBI GenBank Nucleotide #: NM_080617
• UniProt Accession #: Q9NTU7
• Molecular Weight: 22kDa
• NCBI Official Full Name: cerebellin-4
• NCBI Official Synonym Full Names: cerebellin 4 precursor
• NCBI Official Symbol: CBLN4
• NCBI Official Synonym Symbols: CBLNL1
• NCBI Protein Information: cerebellin-4
• UniProt Protein Name: Cerebellin-4
• Protein Family: Cerebellin
• UniProt Gene Name: CBLN4
• UniProt Synonym Gene Names: CBLNL1
• UniProt Entry Name: CBLN4_HUMAN

NCBI Description

This gene encodes a member of a family of small secreted proteins containing C1Q domains. Members of this family are involved in regulation of neurexin signalling during synapse development. The mouse homolog of the protein encoded by this gene competes with netrin to bind to the deleted in colorectal cancer receptor. [provided by RefSeq, Aug 2012]

Uniprot Description

CBLN4: May be involved in synaptic functions in the CNS. Can enable ER export and secretion of CBLN3.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: extracellular space; synapse; cell junction

Biological Process: protein secretion