Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LIN7C Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysatesLIN7C is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit LIN7C Polyclonal Antibody | anti-LIN7C antibody

LIN7C antibody - middle region

Gene Names
LIN7C; MALS3; VELI3; LIN-7C; MALS-3; LIN-7-C
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
LIN7C; Polyclonal Antibody; LIN7C antibody - middle region; anti-LIN7C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV
Sequence Length
197
Applicable Applications for anti-LIN7C antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LIN7C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LIN7C Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysatesLIN7C is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-LIN7C Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysatesLIN7C is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-LIN7C antibody
This is a rabbit polyclonal antibody against LIN7C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. LIN7C ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. It is also required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
protein lin-7 homolog C
NCBI Official Synonym Full Names
lin-7 homolog C, crumbs cell polarity complex component
NCBI Official Symbol
LIN7C
NCBI Official Synonym Symbols
MALS3; VELI3; LIN-7C; MALS-3; LIN-7-C
NCBI Protein Information
protein lin-7 homolog C
UniProt Protein Name
Protein lin-7 homolog C
Protein Family
UniProt Gene Name
LIN7C
UniProt Synonym Gene Names
MALS3; VELI3; Lin-7C; MALS-3; Veli-3
UniProt Entry Name
LIN7C_HUMAN

Uniprot Description

LIN7C: Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. Belongs to the lin-7 family.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 11p14

Cellular Component: postsynaptic membrane; neuron projection; tight junction; basolateral plasma membrane; cytoplasm; postsynaptic density; plasma membrane; synapse; intercellular junction

Molecular Function: protein domain specific binding; cytoskeletal protein binding; PDZ domain binding

Biological Process: asymmetric protein localization; protein transport; exocytosis; neurotransmitter secretion; morphogenesis of an epithelial sheet; maintenance of epithelial cell polarity

Research Articles on LIN7C

Similar Products

Product Notes

The LIN7C lin7c (Catalog #AAA3206605) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIN7C antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LIN7C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the LIN7C lin7c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGGKEQNSPI YISRIIPGGI ADRHGGLKRG DQLLSVNGVS VEGEHHEKAV. It is sometimes possible for the material contained within the vial of "LIN7C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.