Western Blot (WB)
(WB Suggested Anti-CAB39 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Rabbit CAB39 Polyclonal Antibody | anti-CAB39 antibody
CAB39 antibody - middle region
Gene Names
CAB39; MO25; CGI-66
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAB39; Polyclonal Antibody; CAB39 antibody - middle region; anti-CAB39 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP
Sequence Length
341
Applicable Applications for anti-CAB39 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAB39
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CAB39 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-CAB39 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-CAB39 antibody
This is a rabbit polyclonal antibody against CAB39. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.
Target Description: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.
Product Categories/Family for anti-CAB39 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
calcium-binding protein 39
NCBI Official Synonym Full Names
calcium binding protein 39
NCBI Official Symbol
CAB39
NCBI Official Synonym Symbols
MO25; CGI-66
NCBI Protein Information
calcium-binding protein 39
UniProt Protein Name
Calcium-binding protein 39
Protein Family
UniProt Gene Name
CAB39
UniProt Synonym Gene Names
MO25
UniProt Entry Name
CAB39_HUMAN
Uniprot Description
CAB39: a adaptor protein that, together with STRAD-alpha, forms a regulatory complex capable of stimulating the activity of LKB1. Interacts with Mst4, which plays an essential role in brush border formation in intestinal epithelial cells.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 2q37.1
Cellular Component: cytosol
Molecular Function: protein serine/threonine kinase activator activity; protein serine/threonine kinase activity; protein binding; kinase binding; protein kinase activator activity
Biological Process: protein heterooligomerization; activation of protein kinase activity; insulin receptor signaling pathway; cell cycle arrest; protein amino acid phosphorylation; positive regulation of peptidyl-serine phosphorylation
Research Articles on CAB39
Similar Products
Product Notes
The CAB39 cab39 (Catalog #AAA3213054) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAB39 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAB39 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAB39 cab39 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTQPILDILL KNQAKLIEFL SKFQNDRTED EQFNDEKTYL VKQIRDLKRP. It is sometimes possible for the material contained within the vial of "CAB39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
