Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CA8 Antibody Titration: 5.0ug/mlPositive Control: SK-MEL-2 cell lysateCA8 is supported by BioGPS gene expression data to be expressed in SKMEL2)

Rabbit CA8 Polyclonal Antibody | anti-CA8 antibody

CA8 antibody - N-terminal region

Gene Names
CA8; CALS; CARP; CA-RP; CAMRQ3; CA-VIII
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CA8; Polyclonal Antibody; CA8 antibody - N-terminal region; anti-CA8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC
Sequence Length
290
Applicable Applications for anti-CA8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CA8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CA8 Antibody Titration: 5.0ug/mlPositive Control: SK-MEL-2 cell lysateCA8 is supported by BioGPS gene expression data to be expressed in SKMEL2)

Western Blot (WB) (WB Suggested Anti-CA8 Antibody Titration: 5.0ug/mlPositive Control: SK-MEL-2 cell lysateCA8 is supported by BioGPS gene expression data to be expressed in SKMEL2)
Related Product Information for anti-CA8 antibody
This is a rabbit polyclonal antibody against CA8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
767
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
carbonic anhydrase-related protein isoform a
NCBI Official Synonym Full Names
carbonic anhydrase 8
NCBI Official Symbol
CA8
NCBI Official Synonym Symbols
CALS; CARP; CA-RP; CAMRQ3; CA-VIII
NCBI Protein Information
carbonic anhydrase-related protein
UniProt Protein Name
Carbonic anhydrase-related protein
UniProt Gene Name
CA8
UniProt Synonym Gene Names
CALS; CARP; CA-VIII
UniProt Entry Name
CAH8_HUMAN

NCBI Description

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. Mutations in this gene are associated with cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3). Polymorphisms in this gene are associated with osteoporosis, and overexpression of this gene in osteosarcoma cells suggests an oncogenic role. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

CA8: Does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3). CMARQ3 is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation. Belongs to the alpha-carbonic anhydrase family.

Protein type: Energy Metabolism - nitrogen; Lyase

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: cytoplasm

Molecular Function: carbonate dehydratase activity; zinc ion binding

Biological Process: phosphoinositide-mediated signaling; one-carbon compound metabolic process

Disease: Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 3

Research Articles on CA8

Similar Products

Product Notes

The CA8 ca8 (Catalog #AAA3206225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA8 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CA8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CA8 ca8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEEGVEWGLV FPDANGEYQS PINLNSREAR YDPSLLDVRL SPNYVVCRDC. It is sometimes possible for the material contained within the vial of "CA8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.