Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of C7orf30 expression in transfected 293T cell line by C7orf30 polyclonal antibody. Lane 1: C7orf30 transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human C7orf30 Polyclonal Antibody | anti-MALSU1 antibody

C7orf30 (MALSU1, Mitochondrial Assembly of Ribosomal Large Subunit Protein 1)

Gene Names
MALSU1; mtRsfA; C7orf30
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C7orf30; Polyclonal Antibody; C7orf30 (MALSU1; Mitochondrial Assembly of Ribosomal Large Subunit Protein 1); Anti -C7orf30 (MALSU1; anti-MALSU1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C7orf30.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
Applicable Applications for anti-MALSU1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C7orf30, aa1-234 (NP_612455.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of C7orf30 expression in transfected 293T cell line by C7orf30 polyclonal antibody. Lane 1: C7orf30 transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C7orf30 expression in transfected 293T cell line by C7orf30 polyclonal antibody. Lane 1: C7orf30 transfected lysate (25.74kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MALSU1 antibody
May function as a ribosomal silencing factor. Addition to isolated mitochondrial ribosomal subunits partially inhibits translation. Interacts with mitochondrial ribosomal protein L14 (MRPL14), probably blocking formation of intersubunit bridge B8, preventing association of the 28S and 39S ribosomal subunits and the formation of functional ribosomes, thus repressing translation. May also participate in the assembly and/or regulation of the stability of the large subunit of the mitochondrial ribosome.
Product Categories/Family for anti-MALSU1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,170 Da
NCBI Official Full Name
chromosome 7 open reading frame 30
NCBI Official Synonym Full Names
mitochondrial assembly of ribosomal large subunit 1
NCBI Official Symbol
MALSU1
NCBI Official Synonym Symbols
mtRsfA; C7orf30
NCBI Protein Information
mitochondrial assembly of ribosomal large subunit protein 1
UniProt Protein Name
Mitochondrial assembly of ribosomal large subunit protein 1
UniProt Gene Name
MALSU1
UniProt Synonym Gene Names
C7orf30
UniProt Entry Name
MASU1_HUMAN

Uniprot Description

MALSU1: May function as a ribosomal silencing factor. Addition to isolated mitochondrial ribosomal subunits partially inhibits translation. Interacts with mitochondrial ribosomal protein L14 (MRPL14), probably blocking formation of intersubunit bridge B8, preventing association of the 28S and 39S ribosomal subunits and the formation of functional ribosomes, thus repressing translation. May also participate in the assembly and/or regulation of the stability of the large subunit of the mitochondrial ribosome. Belongs to the Iojap/RsfS family.

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: mitochondrion; mitochondrial matrix; cytoplasm

Molecular Function: ribosomal large subunit binding

Biological Process: ribosomal large subunit biogenesis and assembly

Research Articles on MALSU1

Similar Products

Product Notes

The MALSU1 malsu1 (Catalog #AAA643155) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C7orf30 (MALSU1, Mitochondrial Assembly of Ribosomal Large Subunit Protein 1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C7orf30 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MALSU1 malsu1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGPGGRVARL LAPLMWRRAV SSVAGSAVGA EPGLRLLAVQ RLPVGAAFCR ACQTPNFVRG LHSEPGLEER AEGTVNEGRP ESDAADHTGP KFDIDMMVSL LRQENARDIC VIQVPPEMRY TDYFVIVSGT STRHLHAMAF YVVKMYKHLK CKRDPHVKIE GKDTDDWLCV DFGSMVIHLM LPETREIYEL EKLWTLRSYD DQLAQIAPET VPEDFILGIE DDTSSVTPVE LKCE. It is sometimes possible for the material contained within the vial of "C7orf30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.