Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MRPS11 expression in transfected 293T cell line by MRPS11 polyclonal antibody. Lane 1: MRPS11 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human MRPS11 Polyclonal Antibody | anti-mrps11 antibody

MRPS11 (28S Ribosomal Protein S11, Mitochondrial, MRP-S11, S11mt, Cervical Cancer Proto-oncogene 2 Protein, HCC-2, RPMS11, HCC2m, FLJ22512, FLJ23406)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MRPS11; Polyclonal Antibody; MRPS11 (28S Ribosomal Protein S11; Mitochondrial; MRP-S11; S11mt; Cervical Cancer Proto-oncogene 2 Protein; HCC-2; RPMS11; HCC2m; FLJ22512; FLJ23406); Anti -MRPS11 (28S Ribosomal Protein S11; anti-mrps11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MRPS11.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
Applicable Applications for anti-mrps11 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MRPS11, aa1-194 (NP_073750.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MRPS11 expression in transfected 293T cell line by MRPS11 polyclonal antibody. Lane 1: MRPS11 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MRPS11 expression in transfected 293T cell line by MRPS11 polyclonal antibody. Lane 1: MRPS11 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-mrps11 antibody
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms.
Product Categories/Family for anti-mrps11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
mitochondrial ribosomal protein S11
NCBI Official Synonym Full Names
mitochondrial ribosomal protein S11
NCBI Official Symbol
mrps11
NCBI Protein Information
mitochondrial ribosomal protein S11
Protein Family

Similar Products

Product Notes

The mrps11 (Catalog #AAA6002078) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MRPS11 (28S Ribosomal Protein S11, Mitochondrial, MRP-S11, S11mt, Cervical Cancer Proto-oncogene 2 Protein, HCC-2, RPMS11, HCC2m, FLJ22512, FLJ23406) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRPS11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the mrps11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQAVRNAGSR FLRSWTWPQT AGRVVARTPA GTICTGARQL QDAAAKQKVE QNAAPSHTKF SIYPPIPGEE SSLRWAGKKF EEIPIAHIKA SHNNTQIQVV SASNEPLAFA SCGTEGFRNA KKGTGIAAQT AGIAAAARAK QKGVIHIRVV VKGLGPGRLS AMHGLIMGGL EVISITDNTP IPHNGCRPRK ARKL. It is sometimes possible for the material contained within the vial of "MRPS11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.