Western Blot (WB)
(C17ORF71 antibody (MBS5303062) used at 1 ug/ml to detect target protein.)
Rabbit C17ORF71 Polyclonal Antibody | anti-C17ORF71 antibody
C17ORF71 antibody
Gene Names
SMG8; C17orf71
Applications
Western Blot
Purity
Affinity purified
Synonyms
C17ORF71; Polyclonal Antibody; C17ORF71 antibody; Polyclonal C17ORF71; Anti-C17ORF71; Chromosome ORF-17; FLJ10587; Chromosome ORF 17; Chromosome 17 ORF; anti-C17ORF71 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C17ORF71 antibody was raised against the middle region of C17Orf71
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF71 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
584
Applicable Applications for anti-C17ORF71 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).
Cross-Reactivity
Human
Immunogen
C17ORF71 antibody was raised using the middle region of C17Orf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C17ORF71 antibody (MBS5303062) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C17ORF71 antibody (MBS5303062) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C17ORF71 antibody
Rabbit polyclonal C17ORF71 antibody raised against the middle region of C17Orf71
Product Categories/Family for anti-C17ORF71 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
110 kDa (MW of target protein)
NCBI Official Full Name
C17orf71 protein, partial
NCBI Official Synonym Full Names
SMG8 nonsense mediated mRNA decay factor
NCBI Official Symbol
SMG8
NCBI Official Synonym Symbols
C17orf71
NCBI Protein Information
protein SMG8
UniProt Protein Name
Protein SMG8
UniProt Gene Name
SMG8
UniProt Synonym Gene Names
ABC2; C17orf71
UniProt Entry Name
SMG8_HUMAN
Uniprot Description
SMG8: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited by release factors to stalled ribosomes together with SMG1 and SMG9 (forming the SMG1C protein kinase complex) and, in the SMG1C complex, is required to mediate the recruitment of SMG1 to the ribosome:SURF complex and to suppress SMG1 kinase activity until the ribosome:SURF complex locates the exon junction complex (EJC). Acts as a regulator of kinase activity. Belongs to the SMG8 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA processing
Chromosomal Location of Human Ortholog: 17q22
Cellular Component: cytosol
Molecular Function: protein binding
Biological Process: mRNA catabolic process, nonsense-mediated decay; gene expression; regulation of protein kinase activity
Research Articles on C17ORF71
Similar Products
Product Notes
The C17ORF71 smg8 (Catalog #AAA5303062) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C17ORF71 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C17ORF71 smg8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C17ORF71, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
