Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RNASEH1 antibody (MBS839023) used at 1 ug/ml to detect target protein.)

Rabbit RNASEH1 Polyclonal Antibody | anti-RNASEH1 antibody

RNASEH1 antibody

Gene Names
RNASEH1; RNH1; H1RNA
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
RNASEH1; Polyclonal Antibody; RNASEH1 antibody; Polyclonal RNASEH1; Anti-RNASEH1; H1RNA; Ribonuclease H1; anti-RNASEH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
RNASEH1 antibody was raised against the middle region of RNASEH1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASEH1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
286
Applicable Applications for anti-RNASEH1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(RNASEH1 antibody (MBS839023) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (RNASEH1 antibody (MBS839023) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-RNASEH1 antibody
Rabbit polyclonal RNASEH1 antibody raised against the middle region of RNASEH1
Product Categories/Family for anti-RNASEH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32 kDa (MW of target protein)
NCBI Official Full Name
RNASEH1
NCBI Official Synonym Full Names
ribonuclease H1
NCBI Official Symbol
RNASEH1
NCBI Official Synonym Symbols
RNH1; H1RNA
NCBI Protein Information
ribonuclease H1
UniProt Protein Name
Ribonuclease H1
Protein Family
UniProt Gene Name
RNASEH1
UniProt Synonym Gene Names
RNH1; RNase H1
UniProt Entry Name
RNH1_HUMAN

NCBI Description

This gene encodes an endonuclease that specifically degrades the RNA of RNA-DNA hybrids and is necessary for DNA replication and repair. This enzyme is present in both mitochondria and nuclei, which are resulted from translation of a single mRNA with two in-frame initiation start codons. The use of the first start codon produces the mitochondrial isoform and the use of the second start codon produces the nuclear isoform. The production of the mitochondrial isoform is modulated by an upstream open reading frame (uORF) which overlaps the first initiation start codon in human. An alternately spliced transcript variant has been found which encodes a shorter isoform. This gene has three pseudogenes; two of them are at different locations of chromosome 17 and one of them is on chromosome 1q32.2. [provided by RefSeq, Sep 2014]

Uniprot Description

RNASEH1: Endonuclease that specifically degrades the RNA of RNA- DNA hybrids. Belongs to the RNase H family.

Protein type: Mitochondrial; RNA-binding; Ribonuclease; EC 3.1.26.4

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: mitochondrion; nucleus

Molecular Function: protein homodimerization activity; nucleic acid binding; RNA binding; magnesium ion binding; ribonuclease H activity; ribonuclease activity

Biological Process: RNA catabolic process; mitochondrial DNA replication; termination of RNA polymerase II transcription

Disease: Progressive External Ophthalmoplegia With Mitochondrial Dna Deletions, Autosomal Recessive 2

Research Articles on RNASEH1

Similar Products

Product Notes

The RNASEH1 rnaseh1 (Catalog #AAA839023) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASEH1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNASEH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the RNASEH1 rnaseh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNASEH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.