Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HNRPA0 antibody (MBS5302169) used at 0.625 ug/ml to detect target protein.)

Rabbit HNRPA0 Polyclonal Antibody | anti-HNRPA0 antibody

HNRPA0 antibody

Gene Names
HNRNPA0; HNRPA0
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
HNRPA0; Polyclonal Antibody; HNRPA0 antibody; Polyclonal HNRPA0; Anti-HNRPA0; Heterogeneous Nuclear Ribonucleoprotein A0; anti-HNRPA0 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
HNRPA0 antibody was raised against the middle region of HNRPA0
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA0 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
305
Applicable Applications for anti-HNRPA0 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 0.625 ug/ml
IHC: 4-8 ug/ml
Biological Significance
HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
Cross-Reactivity
Human
Immunogen
HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(HNRPA0 antibody (MBS5302169) used at 0.625 ug/ml to detect target protein.)

Western Blot (WB) (HNRPA0 antibody (MBS5302169) used at 0.625 ug/ml to detect target protein.)

Immunohistochemistry (IHC)

(HNRPA0 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)

Immunohistochemistry (IHC) (HNRPA0 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)
Related Product Information for anti-HNRPA0 antibody
Rabbit polyclonal HNRPA0 antibody raised against the middle region of HNRPA0
Product Categories/Family for anti-HNRPA0 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Symbol
HNRNPA0
NCBI Official Synonym Symbols
HNRPA0
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A0
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A0
UniProt Gene Name
HNRNPA0
UniProt Synonym Gene Names
HNRPA0; hnRNP A0
UniProt Entry Name
ROA0_HUMAN

NCBI Description

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP A0: a ubiquitously expressed heterogeneous nuclear ribonucleoprotein (hnRNP) of the A/B subfamily. hnRNPs are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. Has two repeats of RNA recognition motif domains (RRM), followed by a glycine-rich C-terminus.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; ribonucleoprotein complex; nucleus

Molecular Function: RNA binding; nucleotide binding; AU-rich element binding; protein kinase binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression; response to lipopolysaccharide; inflammatory response; mRNA processing

Research Articles on HNRPA0

Similar Products

Product Notes

The HNRPA0 hnrnpa0 (Catalog #AAA5302169) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPA0 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 0.625 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the HNRPA0 hnrnpa0 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPA0, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.