Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIAA0427 antibody (MBS5301221) used at 1 ug/ml to detect target protein.)

Rabbit KIAA0427 Polyclonal Antibody | anti-KIAA0427 antibody

KIAA0427 antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
KIAA0427; Polyclonal Antibody; KIAA0427 antibody; Polyclonal KIAA0427; Anti-KIAA0427; KIAA0 427; Gm672; KIAA0-427; Kiaa0427; anti-KIAA0427 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
KIAA0427 antibody was raised against the N terminal of KIAA0427
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0427 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
601
Applicable Applications for anti-KIAA0427 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay. On mRNAs without PTCs, the CBP80/CBP20 complex is replaced with cytoplasmic mRNA cap-binding proteins, including EIF4G, and steady-state translation of the mRNAs resumes in the cytoplasm.
Cross-Reactivity
Human
Immunogen
KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KIAA0427 antibody (MBS5301221) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KIAA0427 antibody (MBS5301221) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KIAA0427 antibody
Rabbit polyclonal KIAA0427 antibody raised against the N terminal of KIAA0427
Product Categories/Family for anti-KIAA0427 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
67 kDa (MW of target protein)
NCBI Official Full Name
KIAA0427, partial
UniProt Protein Name
CBP80/20-dependent translation initiation factor
UniProt Gene Name
CTIF
UniProt Synonym Gene Names
KIAA0427
UniProt Entry Name
CTIF_HUMAN

Uniprot Description

CTIF: Specifically required for the pioneer round of mRNA translation mediated by the cap-binding complex (CBC), that takes place during or right after mRNA export via the nuclear pore complex (NPC). Acts via its interaction with the NCBP1/CBP80 component of the CBC complex and recruits the 40S small subunit of the ribosome via eIF3. In contrast, it is not involved in steady state translation, that takes place when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. Also required for nonsense-mediated mRNA decay (NMD), the pioneer round of mRNA translation mediated by the cap-binding complex playing a central role in nonsense-mediated mRNA decay (NMD). Belongs to the CTIF family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: perinuclear region of cytoplasm; cytoplasm

Molecular Function: protein binding; RNA binding

Biological Process: mRNA catabolic process, nonsense-mediated decay; regulation of translational initiation

Similar Products

Product Notes

The KIAA0427 ctif (Catalog #AAA5301221) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KIAA0427 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KIAA0427 ctif for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA0427, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.