Western Blot (WB)
(Host: RabbitTarget Name: C10orf90Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit C10orf90 Polyclonal Antibody | anti-C10ORF90 antibody
C10orf90 Antibody - C-terminal region
Gene Names
C10orf90; FATS; bA422P15.2
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C10orf90; Polyclonal Antibody; C10orf90 Antibody - C-terminal region; anti-C10ORF90 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA
Sequence Length
699
Applicable Applications for anti-C10ORF90 antibody
Western Blot (WB)
Homology
Guinea Pig: 85%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C10orf90
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: C10orf90Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C10orf90Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-C10ORF90 antibody
This is a rabbit polyclonal antibody against C10orf90. It was validated on Western Blot
Target Description: C10orf90 is a tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. It mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. It may have a role in the assembly of primary cilia.
Target Description: C10orf90 is a tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. It mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. It may have a role in the assembly of primary cilia.
Product Categories/Family for anti-C10ORF90 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
(E2-independent) E3 ubiquitin-conjugating enzyme FATS isoform 2
NCBI Official Synonym Full Names
chromosome 10 open reading frame 90
NCBI Official Symbol
C10orf90
NCBI Official Synonym Symbols
FATS; bA422P15.2
NCBI Protein Information
(E2-independent) E3 ubiquitin-conjugating enzyme FATS; centrosomal protein C10orf90
UniProt Protein Name
Centrosomal protein C10orf90
Protein Family
UniProt Gene Name
C10orf90
UniProt Synonym Gene Names
FATS
UniProt Entry Name
CJ090_HUMAN
Uniprot Description
C10orf90: Tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. Mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. May have a role in the assembly of primary cilia. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Tumor suppressor
Chromosomal Location of Human Ortholog: 10q26.2
Cellular Component: centrosome; cytoplasm; actin cytoskeleton
Molecular Function: histone deacetylase binding
Biological Process: protein stabilization; mitotic cell cycle G2/M transition DNA damage checkpoint; response to ionizing radiation; negative regulation of cell growth; response to UV
Research Articles on C10ORF90
Similar Products
Product Notes
The C10ORF90 c10orf90 (Catalog #AAA3217713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10orf90 Antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C10orf90 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C10ORF90 c10orf90 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDVCASLQED NGVQIESKFP KGDYTCCDLV VKIKECKKSE DPTTPEPSPA. It is sometimes possible for the material contained within the vial of "C10orf90, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
