Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CINPSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CINP Polyclonal Antibody | anti-CINP antibody

CINP Antibody - N-terminal region

Reactivity
Guinea Pig, Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CINP; Polyclonal Antibody; CINP Antibody - N-terminal region; anti-CINP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQ
Sequence Length
212
Applicable Applications for anti-CINP antibody
Western Blot (WB)
Homology
Guinea Pig: 85%; Human: 100%; Mouse: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CINP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CINPSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CINPSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CINP antibody
This is a rabbit polyclonal antibody against CINP. It was validated on Western Blot

Target Description: The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
cyclin-dependent kinase 2-interacting protein isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase 2 interacting protein
NCBI Official Symbol
CINP
NCBI Protein Information
cyclin-dependent kinase 2-interacting protein
UniProt Protein Name
Cyclin-dependent kinase 2-interacting protein
UniProt Gene Name
CINP
UniProt Synonym Gene Names
CDK2-interacting protein
UniProt Entry Name
CINP_HUMAN

NCBI Description

The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

CINP: Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling. Belongs to the CINP family.

Protein type: Motility/polarity/chemotaxis; Cell cycle regulation

Chromosomal Location of Human Ortholog: 14q32.31

Cellular Component: nucleus

Molecular Function: protein binding

Biological Process: cell division; DNA repair; cell cycle; DNA replication

Research Articles on CINP

Similar Products

Product Notes

The CINP cinp (Catalog #AAA3216363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CINP Antibody - N-terminal region reacts with Guinea Pig, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CINP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CINP cinp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLLNKDKIEL DSSSPASKEN EEKVCLEYNE ELEKLCEELQ ATLDGLTKIQ. It is sometimes possible for the material contained within the vial of "CINP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.