Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BPHLSample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BPHL Polyclonal Antibody | anti-BPHL antibody

BPHL Antibody - middle region

Gene Names
BPHL; MCNAA; BPH-RP; VACVASE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BPHL; Polyclonal Antibody; BPHL Antibody - middle region; anti-BPHL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMK
Sequence Length
274
Applicable Applications for anti-BPHL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BPHL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BPHLSample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BPHLSample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BPHL antibody
This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-BPHL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
670
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
valacyclovir hydrolase isoform 1
NCBI Official Synonym Full Names
biphenyl hydrolase like
NCBI Official Symbol
BPHL
NCBI Official Synonym Symbols
MCNAA; BPH-RP; VACVASE
NCBI Protein Information
valacyclovir hydrolase
UniProt Protein Name
Valacyclovir hydrolase
Protein Family
UniProt Gene Name
BPHL
UniProt Synonym Gene Names
MCNAA; VACVase; Valacyclovirase; Bph-rp; MCNAA
UniProt Entry Name
BPHL_HUMAN

NCBI Description

This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jan 2009]

Uniprot Description

BPHL: Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol. Belongs to the AB hydrolase superfamily. Lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 6p25

Cellular Component: mitochondrion

Molecular Function: hydrolase activity

Biological Process: amino acid metabolic process; response to toxin

Research Articles on BPHL

Similar Products

Product Notes

The BPHL bphl (Catalog #AAA3222052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BPHL Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BPHL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BPHL bphl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGPQLKNLNK KLFTVVAWDP RGYGHSRPPD RDFPADFFER DAKDAVDLMK. It is sometimes possible for the material contained within the vial of "BPHL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.