Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CD47 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)

CD47 active protein

Recombinant Human CD47 Protein

Gene Names
CD47; IAP; OA3; MER6
Purity
>97% by SDS-PAGE.
Synonyms
CD47; Recombinant Human CD47 Protein; IAP; MER6; OA3; CD47 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Sequence Length
323
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA.Immobilized Human SIRP alpha at 2 ug/mL (100 uL/well) can bind Human CD47 with a linear range of 7-20ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD47 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)

SDS-Page (Recombinant Human CD47 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-70 kDa.)
Related Product Information for CD47 active protein
Description: Recombinant Human CD47 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln19-Pro139) of human CD47 (Accession #NP_001768.1) fused with an Fc, 6xHis tag at the C-terminus.

Background: This protein is a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Product Categories/Family for CD47 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
961
UniProt Accession #
NCBI Official Full Name
Leukocyte surface antigen CD47
NCBI Official Synonym Full Names
CD47 molecule
NCBI Official Symbol
CD47
NCBI Official Synonym Symbols
IAP; OA3; MER6
NCBI Protein Information
leukocyte surface antigen CD47
UniProt Protein Name
Leukocyte surface antigen CD47
Protein Family
UniProt Gene Name
CD47
UniProt Synonym Gene Names
MER6; IAP
UniProt Entry Name
CD47_HUMAN

NCBI Description

This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

CD47: Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q13.1-q13.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding

Biological Process: integrin-mediated signaling pathway; extracellular matrix organization and biogenesis; response to bacterium; positive regulation of phagocytosis; positive regulation of cell proliferation; positive regulation of cell-cell adhesion; positive regulation of T cell activation; opsonization; blood coagulation; cell adhesion; leukocyte migration; positive regulation of inflammatory response

Research Articles on CD47

Similar Products

Product Notes

The CD47 cd47 (Catalog #AAA9141737) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QLLFNKTKSV EFTFCNDTVV IPCFVTNMEA QNTTEVYVKW KFKGRDIYTF DGALNKSTVP TDFSSAKIEV SQLLKGDASL KMDKSDAVSH TGNYTCEVTE LTREGETIIE LKYRVVSWFS P. It is sometimes possible for the material contained within the vial of "CD47, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.