Rabbit anti-Human AUTS2 Polyclonal Antibody | anti-AUTS2 antibody

AUTS2 Antibody - N-terminal region

Cat. Num. AAA3220888

• Gene Names: AUTS2; MRD26; FBRSL2
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: AUTS2; Polyclonal Antibody; AUTS2 Antibody - N-terminal region; anti-AUTS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLC
• Sequence Length: 1259

• Applicable Applications for anti-AUTS2 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AUTS2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AUTS2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-AUTS2 antibody

This gene has been implicated in neurodevelopment and as a candidate gene for numerous neurological disorders, including autism spectrum disorders, intellectual disability, and developmental delay. Mutations in this gene have also been associated with non-neurological disorders, such as acute lymphoblastic leukemia, aging of the skin, early-onset androgenetic alopecia, and certain cancers. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Categories/Family for anti-AUTS2 antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 187829452
• NCBI GeneID: 26053
• NCBI Accession #: NP_001120703.1
• NCBI GenBank Nucleotide #: NM_001127231.2
• UniProt Accession #: Q8WXX7
• Molecular Weight: 139 kDa
• NCBI Official Full Name: autism susceptibility gene 2 protein isoform 2
• NCBI Official Synonym Full Names: activator of transcription and developmental regulator AUTS2
• NCBI Official Symbol: AUTS2
• NCBI Official Synonym Symbols: MRD26; FBRSL2
• NCBI Protein Information: autism susceptibility gene 2 protein
• UniProt Protein Name: Autism susceptibility gene 2 protein
• Protein Family: Autism susceptibility gene 2 protein
• UniProt Gene Name: AUTS2
• UniProt Synonym Gene Names: KIAA0442

NCBI Description

This gene has been implicated in neurodevelopment and as a candidate gene for numerous neurological disorders, including autism spectrum disorders, intellectual disability, and developmental delay. Mutations in this gene have also been associated with non-neurological disorders, such as acute lymphoblastic leukemia, aging of the skin, early-onset androgenetic alopecia, and certain cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2014]

Uniprot Description

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:25519132). The PRC1-like complex that contains PCGF5, RNF2, CSNK2B, RYBP and AUTS2 has decreased histone H2A ubiquitination activity, due to the phosphorylation of RNF2 by CSNK2B (PubMed:25519132). As a consequence, the complex mediates transcriptional activation (PubMed:25519132). In the cytoplasm, plays a role in axon and dendrite elongation and in neuronal migration during embryonic brain development. Promotes reorganization of the actin cytoskeleton, lamellipodia formation and neurite elongation via its interaction with RAC guanine nucleotide exchange factors, which then leads to the activation of RAC1 ().