Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UBIAD1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human UBIAD1 Polyclonal Antibody | anti-UBIAD1 antibody

UBIAD1 Antibody - N-terminal region

Gene Names
UBIAD1; SCCD; TERE1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBIAD1; Polyclonal Antibody; UBIAD1 Antibody - N-terminal region; anti-UBIAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNT
Sequence Length
218
Applicable Applications for anti-UBIAD1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UBIAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UBIAD1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UBIAD1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-UBIAD1 antibody
This gene encodes a protein thought to be involved in cholesterol and phospholipid metabolism. Mutations in this gene are associated with Schnyder crystalline corneal dystrophy.
Product Categories/Family for anti-UBIAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
ubiA prenyltransferase domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
UbiA prenyltransferase domain containing 1
NCBI Official Symbol
UBIAD1
NCBI Official Synonym Symbols
SCCD; TERE1
NCBI Protein Information
ubiA prenyltransferase domain-containing protein 1
UniProt Protein Name
UbiA prenyltransferase domain-containing protein 1
UniProt Gene Name
UBIAD1
UniProt Synonym Gene Names
TERE1
UniProt Entry Name
UBIA1_HUMAN

NCBI Description

This gene encodes a protein thought to be involved in cholesterol and phospholipid metabolism. Mutations in this gene are associated with Schnyder crystalline corneal dystrophy. [provided by RefSeq, Oct 2008]

Uniprot Description

UBIAD1: Prenyltransferase that mediates the formation of menaquinone-4 (MK-4), a vitamin K2 isoform present at high concentrations in the brain, kidney and pancreas. Mediates the conversion of phylloquinone (PK) into menaquinone-4 (MK-4), probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4. Defects in UBIAD1 are the cause of crystalline corneal dystrophy of Schnyder (SCCD). SCCD is a rare autosomal dominant disease characterized by progressive corneal opacification resulting from abnormal deposition of cholesterol and phospholipids. Belongs to the UbiA prenyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.5.1.-; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; mitochondrial membrane; cytoplasm; integral to Golgi membrane; nucleus

Molecular Function: antioxidant activity; protein binding; prenyltransferase activity

Biological Process: menaquinone biosynthetic process; ubiquinone biosynthetic process; vitamin K biosynthetic process

Disease: Schnyder Corneal Dystrophy

Research Articles on UBIAD1

Similar Products

Product Notes

The UBIAD1 ubiad1 (Catalog #AAA3220647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBIAD1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBIAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBIAD1 ubiad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLVYAIPLAL STEAILHSNN TRDMESDREA GIVTLAILIG PTFSYILYNT. It is sometimes possible for the material contained within the vial of "UBIAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.