Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FGF17Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human FGF17 Polyclonal Antibody | anti-FGF17 antibody

FGF17 Antibody - middle region

Gene Names
FGF17; HH20; FGF-13; FGF-17
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FGF17; Polyclonal Antibody; FGF17 Antibody - middle region; anti-FGF17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRL
Sequence Length
167
Applicable Applications for anti-FGF17 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FGF17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FGF17Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FGF17Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FGF17 antibody
This gene encodes a member of the fibroblast growth factor (FGF) family. Member of the FGF family possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is expressed during embryogenesis and in the adult cerebellum and cortex and may be essential for vascular growth and normal brain development. Mutations in this gene are the cause of hypogonadotropic hypogonadism 20 with or without anosmia. Alternate splicing results in multiple transcript variants.
Product Categories/Family for anti-FGF17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
fibroblast growth factor 17 isoform 2
NCBI Official Synonym Full Names
fibroblast growth factor 17
NCBI Official Symbol
FGF17
NCBI Official Synonym Symbols
HH20; FGF-13; FGF-17
NCBI Protein Information
fibroblast growth factor 17
UniProt Protein Name
Fibroblast growth factor 17
Protein Family
UniProt Gene Name
FGF17
UniProt Synonym Gene Names
FGF-17
UniProt Entry Name
FGF17_HUMAN

NCBI Description

This gene encodes a member of the fibroblast growth factor (FGF) family. Member of the FGF family possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is expressed during embryogenesis and in the adult cerebellum and cortex and may be essential for vascular growth and normal brain development. Mutations in this gene are the cause of hypogonadotropic hypogonadism 20 with or without anosmia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

FGF17: Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8p21

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; type 2 fibroblast growth factor receptor binding; type 1 fibroblast growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; nervous system development; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; cell-cell signaling; positive regulation of cell proliferation; insulin receptor signaling pathway; innate immune response; signal transduction

Disease: Hypogonadotropic Hypogonadism 20 With Or Without Anosmia

Research Articles on FGF17

Similar Products

Product Notes

The FGF17 fgf17 (Catalog #AAA3220468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF17 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGF17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FGF17 fgf17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTEIVLENNY TAFQNARHEG WFMAFTRQGR PRQASRSRQN QREAHFIKRL. It is sometimes possible for the material contained within the vial of "FGF17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.