Western Blot (WB)
(Host: RabbitTarget Name: SEZ6L2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Rabbit anti-Human SEZ6L2 Polyclonal Antibody | anti-SEZ6L2 antibody
SEZ6L2 Antibody-N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEZ6L2; Polyclonal Antibody; SEZ6L2 Antibody-N-terminal region; Seizure 6-like protein 2; BSRPA; PSK-1; anti-SEZ6L2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
AGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEP
Applicable Applications for anti-SEZ6L2 antibody
Western Blot (WB)
Protein Size
840 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEZ6L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SEZ6L2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SEZ6L2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Related Product Information for anti-SEZ6L2 antibody
Description of Target: This gene encodes a seizure-related protein that is localized on the cell surface. The gene is located in a region of chromosome 16p11.2 that is thought to contain candidate genes for autism spectrum disorders (ASD), though there is no evidence directly implicating this gene in ASD. Increased expression of this gene has been found in lung cancers, and the protein is therefore considered to be a novel prognostic marker for lung cancer. Alternative splicing of this gene results in multiple transcript variants.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
92kDa
UniProt Protein Name
Seizure 6-like protein 2
Protein Family
UniProt Gene Name
SEZ6L2
UniProt Synonym Gene Names
PSK
UniProt Entry Name
SE6L2_HUMAN
Uniprot Description
SEZ6L2: May contribute to specialized endoplasmic reticulum functions in neurons. Belongs to the SEZ6 family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 16p11.2
Cellular Component: endoplasmic reticulum membrane; plasma membrane; integral to membrane
Similar Products
Product Notes
The SEZ6L2 sez6l2 (Catalog #AAA3249678) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEZ6L2 Antibody-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEZ6L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEZ6L2 sez6l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AGFPVGSHVQ YRCLPGYSLE GAAMLTCYSR DTGTPKWSDR VPKCALKYEP. It is sometimes possible for the material contained within the vial of "SEZ6L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
