Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ATP4B rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in human pancreas.)

Rabbit anti-Human, Mouse ATP4B Polyclonal Antibody | anti-ATP4B antibody

ATP4B (Potassium-transporting ATPase Subunit beta, Gastric H(+)/K(+) ATPase Subunit beta, Proton Pump beta Chain) (Biotin)

Gene Names
ATP4B; ATP6B
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP4B; Polyclonal Antibody; ATP4B (Potassium-transporting ATPase Subunit beta; Gastric H(+)/K(+) ATPase Subunit beta; Proton Pump beta Chain) (Biotin); anti-ATP4B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATP4B. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ATP4B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ATP4B, aa1-291 (AAH29059).
Immunogen Sequence
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ATP4B rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in human pancreas.)

Western Blot (WB) (ATP4B rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in human pancreas.)

Western Blot (WB)

(ATP4B rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in mouse liver.)

Western Blot (WB) (ATP4B rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of ATP4B expression in transfected 293T cell line by ATP4B polyclonal antibody. Lane 1: ATP4B transfected lysate (32.12kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP4B expression in transfected 293T cell line by ATP4B polyclonal antibody. Lane 1: ATP4B transfected lysate (32.12kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATP4B antibody
The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P type cation transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta subunit which may play a role in maintaining the structural and functional integrity of the complex.
Product Categories/Family for anti-ATP4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
496
Molecular Weight
33,367 Da
NCBI Official Full Name
Homo sapiens ATPase, H+/K+ exchanging, beta polypeptide, mRNA
NCBI Official Synonym Full Names
ATPase H+/K+ transporting beta subunit
NCBI Official Symbol
ATP4B
NCBI Official Synonym Symbols
ATP6B
NCBI Protein Information
potassium-transporting ATPase subunit beta

NCBI Description

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]

Research Articles on ATP4B

Similar Products

Product Notes

The ATP4B (Catalog #AAA6370685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP4B (Potassium-transporting ATPase Subunit beta, Gastric H(+)/K(+) ATPase Subunit beta, Proton Pump beta Chain) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ATP4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP4B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.