Mouse anti-Human ATP4B Monoclonal Antibody | anti-ATP4B antibody

ATP4B (Potassium-transporting ATPase Subunit beta, Gastric H(+)/K(+) ATPase Subunit beta, Proton Pump beta Chain) (PE)

Cat. Num. AAA6156641

• Gene Names: ATP4B; ATP6B
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP4B; Monoclonal Antibody; ATP4B (Potassium-transporting ATPase Subunit beta; Gastric H(+)/K(+) ATPase Subunit beta; Proton Pump beta Chain) (PE); anti-ATP4B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D10
• Specificity: Recognizes human ATP4B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ATP4B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa67-176 from human ATP4B (NP_000696.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged ATP4B is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-ATP4B antibody

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P type cation transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta subunit which may play a role in maintaining the structural and functional integrity of the complex.

Product Categories/Family for anti-ATP4B antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 4557339
• NCBI GeneID: 496
• NCBI Accession #: NP_000696.1
• NCBI GenBank Nucleotide #: NM_000705
• UniProt Accession #: P51164; B1B0N8
• Molecular Weight: 33,367 Da
• NCBI Official Full Name: potassium-transporting ATPase subunit beta
• NCBI Official Synonym Full Names: ATPase H+/K+ transporting beta subunit
• NCBI Official Symbol: ATP4B
• NCBI Official Synonym Symbols: ATP6B
• NCBI Protein Information: potassium-transporting ATPase subunit beta
• UniProt Protein Name: Potassium-transporting ATPase subunit beta
• Protein Family: Potassium-transporting ATPase
• UniProt Gene Name: ATP4B

NCBI Description

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP4B: belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: plasma membrane

Molecular Function: hydrogen:potassium-exchanging ATPase activity; protein binding