Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATP4B expression in transfected 293T cell line by ATP4B polyclonal antibody. Lane 1: ATP4B transfected lysate (32.12kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ATP4B Polyclonal Antibody

ATP4B (Potassium-transporting ATPase Subunit beta, Gastric H(+)/K(+) ATPase Subunit beta, Proton Pump beta Chain)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ATP4B; Polyclonal Antibody; ATP4B (Potassium-transporting ATPase Subunit beta; Gastric H(+)/K(+) ATPase Subunit beta; Proton Pump beta Chain); Anti -ATP4B (Potassium-transporting ATPase Subunit beta; anti-ATP4B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATP4B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Applicable Applications for anti-ATP4B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ATP4B, aa1-291 (AAH29059).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP4B expression in transfected 293T cell line by ATP4B polyclonal antibody. Lane 1: ATP4B transfected lysate (32.12kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATP4B expression in transfected 293T cell line by ATP4B polyclonal antibody. Lane 1: ATP4B transfected lysate (32.12kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATP4B antibody
The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P type cation transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta subunit which may play a role in maintaining the structural and functional integrity of the complex.
Product Categories/Family for anti-ATP4B antibody

Similar Products

Product Notes

The ATP4B (Catalog #AAA648280) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATP4B (Potassium-transporting ATPase Subunit beta, Gastric H(+)/K(+) ATPase Subunit beta, Proton Pump beta Chain) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ATP4B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAALQEKKTC GQRMEEFQRY CWNPDTGQML GRTLSRWVWI SLYYVAFYVV MTGLFALCLY VLMQTVDPYT PDYQDQLRSP GVTLRPDVYG EKGLEIVYNV SDNRTWADLT QTLHAFLAGY SPAAQEDSIN CTSEQYFFQE SFRAPNHTKF SCKFTADMLQ NCSGLADPNF GFEEGKPCFI IKMNRIVKFL PSNGSAPRVD CAFLDQPREL GQPLQVKYYP PNGTFSLHYF PYYGKKAQPH YSNPLVAAKL LNIPRNAEVA IVCKVMAEHV TFNNPHDPYE GKVEFKLKIE K. It is sometimes possible for the material contained within the vial of "ATP4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.