Immunohistochemistry (IHC)
(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: ATP2A1Gene Name :ATP2A1Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)
Rabbit ATP2A1 Polyclonal Antibody | anti-ATP2A1 antibody
ATP2A1 antibody - N-terminal region
Gene Names
ATP2A1; ATP2A; SERCA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ATP2A1; Polyclonal Antibody; ATP2A1 antibody - N-terminal region; anti-ATP2A1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
Sequence Length
994
Applicable Applications for anti-ATP2A1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP2A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: ATP2A1Gene Name :ATP2A1Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)
Immunohistochemistry (IHC)
(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: ATP2A1Gene Name :ATP2A1Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)
Western Blot (WB)
(WB Suggested Anti-ATP2A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ATP2A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-ATP2A1 antibody
This is a rabbit polyclonal antibody against ATP2A1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to
Target Description: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to
Product Categories/Family for anti-ATP2A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
109kDa
NCBI Official Full Name
sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform a
NCBI Official Synonym Full Names
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
NCBI Official Symbol
ATP2A1
NCBI Official Synonym Symbols
ATP2A; SERCA1
NCBI Protein Information
sarcoplasmic/endoplasmic reticulum calcium ATPase 1
UniProt Protein Name
Putative uncharacterized protein DKFZp779O2152
Protein Family
UniProt Gene Name
DKFZp779O2152
UniProt Entry Name
Q7Z675_HUMAN
NCBI Description
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in three transcript variants encoding different isoforms. [provided by RefSeq, Oct 2013]
Research Articles on ATP2A1
Similar Products
Product Notes
The ATP2A1 dkfzp779o2152 (Catalog #AAA3206230) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP2A1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2A1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ATP2A1 dkfzp779o2152 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEAAHAKTTE ECLAYFGVSE TTGLTPDQVK RNLEKYGLNE LPAEEGKTLW. It is sometimes possible for the material contained within the vial of "ATP2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
