Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATP2A3Sample Type: MCF7Antibody Dilution: 1.0ug/mlATP2A3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit ATP2A3 Polyclonal Antibody | anti-ATP2A3 antibody

ATP2A3 antibody - middle region

Gene Names
ATP2A3; SERCA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP2A3; Polyclonal Antibody; ATP2A3 antibody - middle region; anti-ATP2A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS
Sequence Length
999
Applicable Applications for anti-ATP2A3 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Rabbit: 77%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATP2A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATP2A3Sample Type: MCF7Antibody Dilution: 1.0ug/mlATP2A3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: ATP2A3Sample Type: MCF7Antibody Dilution: 1.0ug/mlATP2A3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-ATP2A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateATP2A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-ATP2A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateATP2A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-ATP2A3 antibody
This is a rabbit polyclonal antibody against ATP2A3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ATP2A3 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-ATP2A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
489
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
sarcoplasmic/endoplasmic reticulum calcium ATPase 3 isoform a
NCBI Official Synonym Full Names
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
NCBI Official Symbol
ATP2A3
NCBI Official Synonym Symbols
SERCA3
NCBI Protein Information
sarcoplasmic/endoplasmic reticulum calcium ATPase 3
UniProt Protein Name
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
UniProt Gene Name
ATP2A3
UniProt Synonym Gene Names
SERCA3; SR Ca(2+)-ATPase 3
UniProt Entry Name
AT2A3_HUMAN

NCBI Description

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP2A3: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Hydrolase; Endoplasmic reticulum; Transporter; Transporter, ion channel; EC 3.6.3.8; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; nuclear membrane; sarcoplasmic reticulum; endoplasmic reticulum; integral to membrane

Molecular Function: calcium-transporting ATPase activity; metal ion binding; ATP binding

Biological Process: transport; metabolic process; calcium ion transport; blood coagulation; transmembrane transport

Research Articles on ATP2A3

Similar Products

Product Notes

The ATP2A3 atp2a3 (Catalog #AAA3208251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP2A3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP2A3 atp2a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LISGWLFFRY LAIGVYVGLA TVAAATWWFV YDAEGPHINF YQLRNFLKCS. It is sometimes possible for the material contained within the vial of "ATP2A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.