Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARL3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlARL3 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit ARL3 Polyclonal Antibody | anti-ARL3 antibody

ARL3 antibody - N-terminal region

Gene Names
ARL3; RP83; ARFL3; JBTS35
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARL3; Polyclonal Antibody; ARL3 antibody - N-terminal region; anti-ARL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP
Sequence Length
182
Applicable Applications for anti-ARL3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 77%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ARL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARL3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlARL3 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: ARL3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlARL3 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-ARL3 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellARL3 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-ARL3 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellARL3 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-ARL3 antibody
This is a rabbit polyclonal antibody against ARL3. It was validated on Western Blot

Target Description: ARL3 is required for normal cytokinesis. 'ARL3 does not act as an allosteric activator of the cholera toxin catalytic subunit.
Product Categories/Family for anti-ARL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
403
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ADP-ribosylation factor-like protein 3
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 3
NCBI Official Symbol
ARL3
NCBI Official Synonym Symbols
RP83; ARFL3; JBTS35
NCBI Protein Information
ADP-ribosylation factor-like protein 3
UniProt Protein Name
ADP-ribosylation factor-like protein 3
UniProt Gene Name
ARL3
UniProt Synonym Gene Names
ARFL3
UniProt Entry Name
ARL3_HUMAN

NCBI Description

ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008]

Uniprot Description

ARL3: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). Required for normal cytokinesis and cilia signaling. Requires assistance from GTPase- activating proteins (GAPs) like RP2 and PDE6D, in order to cycle between inactive GDP-bound and active GTP-bound forms. Required for targeting proteins such as NPHP3 to the ciliary membrane by releasing myristoylated NPHP3 from UNC119B cargo adapter into the cilium. Does not act as an allosteric activator of the cholera toxin catalytic subunit. Belongs to the small GTPase superfamily. Arf family.

Protein type: Cell cycle regulation; Cytoskeletal; G protein, monomeric, ARF; G protein, monomeric

Chromosomal Location of Human Ortholog: 10q23.3

Cellular Component: Golgi membrane; Golgi apparatus; centrosome; cytoplasmic microtubule; spindle microtubule; midbody; nucleus; photoreceptor connecting cilium

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; microtubule binding; metal ion binding

Biological Process: photoreceptor cell development; protein transport; smoothened signaling pathway; metabolic process; organelle organization and biogenesis; small GTPase mediated signal transduction; intraflagellar transport; cytokinesis; post-Golgi vesicle-mediated transport; kidney development

Research Articles on ARL3

Similar Products

Product Notes

The ARL3 arl3 (Catalog #AAA3214439) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARL3 arl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QRKIRPYWKN YFENTDILIY VIDSADRKRF EETGQELAEL LEEEKLSCVP. It is sometimes possible for the material contained within the vial of "ARL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.