Mouse anti-Human TRPV5 Monoclonal Antibody | anti-TRPV5 antibody

TRPV5 (Transient Receptor Potential Cation Channel Subfamily V Member 5, TrpV5, Calcium Transport Protein 2, CaT2, Epithelial Calcium Channel 1, ECaC1, ECaC, Osm-9-like TRP Channel 3, OTRPC3) (PE)

Cat. Num. AAA6160856

• Gene Names: TRPV5; CAT2; ECAC1; OTRPC3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TRPV5; Monoclonal Antibody; TRPV5 (Transient Receptor Potential Cation Channel Subfamily V Member 5; TrpV5; Calcium Transport Protein 2; CaT2; Epithelial Calcium Channel 1; ECaC1; ECaC; Osm-9-like TRP Channel 3; OTRPC3) (PE); anti-TRPV5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A6
• Specificity: Recognizes human TRPV5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TRPV5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from human TRPV5 (NP_062815) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(TRPV5 monoclonal antibody. Western Blot analysis of TRPV5 expression in human kidney.)

Testing Data

(Detection limit for recombinant GST tagged TRPV5 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TRPV5 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 730229359
• NCBI GeneID: 56302
• NCBI Accession #: NP_062815
• NCBI GenBank Nucleotide #: NM_019841
• UniProt Accession #: Q9NQA5
• Molecular Weight: 80kDa
• NCBI Official Full Name: transient receptor potential cation channel subfamily V member 5
• NCBI Official Synonym Full Names: transient receptor potential cation channel subfamily V member 5
• NCBI Official Symbol: TRPV5
• NCBI Official Synonym Symbols: CAT2; ECAC1; OTRPC3
• NCBI Protein Information: transient receptor potential cation channel subfamily V member 5
• UniProt Protein Name: Transient receptor potential cation channel subfamily V member 5
• Protein Family: Transient receptor potential cation channel subfamily
• UniProt Gene Name: TRPV5
• UniProt Synonym Gene Names: ECAC11 PublicationManual assertion based on opinion iniRef.1; ECaC; ECaC1; OTRPC3

NCBI Description

This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. [provided by RefSeq, Jul 2008]

Uniprot Description

Constitutively active calcium selective cation channel thought to be involved in Ca2+ reabsorption in kidney and intestine (PubMed:11549322, PubMed:18768590). Required for normal Ca2+ reabsorption in the kidney distal convoluted tubules (). The channel is activated by low internal calcium level and the current exhibits an inward rectification (PubMed:11549322, PubMed:18768590). A Ca2+-dependent feedback regulation includes fast channel inactivation and slow current decay (). Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating ().