Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LILRA1Sample Type: MDA-MB-435S Whole Cell lysatesAntibody Dilution: 1.0ug/mlLILRA1 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

Rabbit anti-Human LILRA1 Polyclonal Antibody | anti-LILRA1 antibody

LILRA1 Antibody - middle region

Gene Names
LILRA1; LIR6; CD85I; LIR-6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LILRA1; Polyclonal Antibody; LILRA1 Antibody - middle region; anti-LILRA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY
Sequence Length
289
Applicable Applications for anti-LILRA1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LILRA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LILRA1Sample Type: MDA-MB-435S Whole Cell lysatesAntibody Dilution: 1.0ug/mlLILRA1 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

Western Blot (WB) (Host: RabbitTarget Name: LILRA1Sample Type: MDA-MB-435S Whole Cell lysatesAntibody Dilution: 1.0ug/mlLILRA1 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)
Related Product Information for anti-LILRA1 antibody
This is a rabbit polyclonal antibody against LILRA1. It was validated on Western Blot

Target Description: LILRA1 may act as receptor for class I MHC antigens.
Product Categories/Family for anti-LILRA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily A member 1 isoform 1
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor A1
NCBI Official Symbol
LILRA1
NCBI Official Synonym Symbols
LIR6; CD85I; LIR-6
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily A member 1
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily A member 1
UniProt Gene Name
LILRA1
UniProt Synonym Gene Names
LIR6; LIR-6
UniProt Entry Name
LIRA1_HUMAN

NCBI Description

This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompatibility complex class I ligands, and contributes to the regulation of immune responses. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

LILRA1: May act as receptor for class I MHC antigens. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity; antigen binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction; immune system process; defense response

Research Articles on LILRA1

Similar Products

Product Notes

The LILRA1 lilra1 (Catalog #AAA3216518) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LILRA1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LILRA1 lilra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGSFILCKEG EDEHPQCLNS QPRTHGWSRA IFSVGPVSPS RRWSYRCYAY. It is sometimes possible for the material contained within the vial of "LILRA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.