Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ARL11 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Rabbit anti-Rat ARL11 Polyclonal Antibody | anti-ARL11 antibody
ARL11 Polyclonal Antibody
Gene Names
ARL11; ARLTS1
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ARL11; Polyclonal Antibody; ARL11 Polyclonal Antibody; ARLTS1; anti-ARL11 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Sequence Length
196
Applicable Applications for anti-ARL11 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ARL11
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
Rat liver, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ARL11 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ARL11 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Related Product Information for anti-ARL11 antibody
This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers.
Product Categories/Family for anti-ARL11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 21kDa
Observed: 21kDa
Observed: 21kDa
NCBI Official Full Name
ADP-ribosylation factor-like protein 11
NCBI Official Synonym Full Names
ADP ribosylation factor like GTPase 11
NCBI Official Symbol
ARL11
NCBI Official Synonym Symbols
ARLTS1
NCBI Protein Information
ADP-ribosylation factor-like protein 11
UniProt Protein Name
ADP-ribosylation factor-like protein 11
Protein Family
UniProt Gene Name
ARL11
UniProt Synonym Gene Names
ARLTS1
NCBI Description
This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]
Uniprot Description
May play a role in apoptosis. May act as a tumor suppressor.
Research Articles on ARL11
Similar Products
Product Notes
The ARL11 arl11 (Catalog #AAA9133282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL11 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARL11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ARL11 arl11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSVNSRGHK AEAQVVMMGL DSAGKTTLLY KLKGHQLVET LPTVGFNVEP LKAPGHVSLT LWDVGGQAPL RASWKDYLEG TDILVYVLDS TDEARLPESA AELTEVLNDP NMAGVPFLVL ANKQEAPDAL PLLKIRNRLS LERFQDHCWE LRGCSALTGE GLPEALQSLW SLLKSRSCMC LQARAHGAER GDSKRS. It is sometimes possible for the material contained within the vial of "ARL11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
