Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TAF13 expression in transfected 293T cell line by TAF13 polyclonal antibody. Lane 1: TAF13 transfected lysate (14.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TAF13 Polyclonal Antibody | anti-TAF13 antibody

TAF13 (Transcription Initiation Factor TFIID Subunit 13, Transcription Initiation Factor TFIID 18kD Subunit, TAF(II)18, TAFII-18, TAFII18, TAF2K, TAFII18, MGC22425) (HRP)

Gene Names
TAF13; TAF2K; TAFII18; TAFII-18; TAF(II)18
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF13; Polyclonal Antibody; TAF13 (Transcription Initiation Factor TFIID Subunit 13; Transcription Initiation Factor TFIID 18kD Subunit; TAF(II)18; TAFII-18; TAFII18; TAF2K; MGC22425) (HRP); anti-TAF13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TAF13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-TAF13 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TAF13, aa1-124 (NP_005636.1).
Immunogen Sequence
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF13 expression in transfected 293T cell line by TAF13 polyclonal antibody. Lane 1: TAF13 transfected lysate (14.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TAF13 expression in transfected 293T cell line by TAF13 polyclonal antibody. Lane 1: TAF13 transfected lysate (14.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TAF13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,287 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 13
NCBI Official Synonym Full Names
TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa
NCBI Official Symbol
TAF13
NCBI Official Synonym Symbols
TAF2K; TAFII18; TAFII-18; TAF(II)18
NCBI Protein Information
transcription initiation factor TFIID subunit 13; transcription initiation factor TFIID 18 kD subunit; transcription initiation factor TFIID 18 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD
UniProt Protein Name
Transcription initiation factor TFIID subunit 13
UniProt Gene Name
TAF13
UniProt Synonym Gene Names
TAF2K; TAFII18; TAF(II)18; TAFII-18; TAFII18
UniProt Entry Name
TAF13_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF13: a TBP-associated factor (TAF). A component of TFIID complexes composed of the TATA binding protein (TBP), TAF10 and TAF11. TAF13 and TAF10 contain non-canonical histone folds, forming a histone-like pair in TFIID complexes.

Protein type: Translation

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: nucleoplasm; transcription factor TFIID complex; nucleolus; nucleus

Molecular Function: protein C-terminus binding; protein binding; DNA binding; protein heterodimerization activity; transcription cofactor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; transcription initiation; RNA elongation from RNA polymerase II promoter; gene expression

Similar Products

Product Notes

The TAF13 taf13 (Catalog #AAA6395877) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF13 (Transcription Initiation Factor TFIID Subunit 13, Transcription Initiation Factor TFIID 18kD Subunit, TAF(II)18, TAFII-18, TAFII18, TAF2K, TAFII18, MGC22425) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF13 taf13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.