Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ARL11 rabbit polyclonal antibody. Western Blot analysis of ARL11 expression in human kidney.)

Rabbit anti-Human ARL11 Polyclonal Antibody | anti-ARL11 antibody

ARL11 (ADP-ribosylation Factor-like Protein 11, ADP-ribosylation Factor-like Tumor Suppressor Protein 1, ARLTS1, FLJ33930, MGC17429) (AP)

Gene Names
ARL11; ARLTS1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARL11; Polyclonal Antibody; ARL11 (ADP-ribosylation Factor-like Protein 11; ADP-ribosylation Factor-like Tumor Suppressor Protein 1; ARLTS1; FLJ33930; MGC17429) (AP); anti-ARL11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ARL11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ARL11 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ARL11, aa1-196 (NP_612459.1).
Immunogen Sequence
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ARL11 rabbit polyclonal antibody. Western Blot analysis of ARL11 expression in human kidney.)

Western Blot (WB) (ARL11 rabbit polyclonal antibody. Western Blot analysis of ARL11 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of ARL11 expression in transfected 293T cell line by ARL11 polyclonal antibody. Lane 1: ARL11 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARL11 expression in transfected 293T cell line by ARL11 polyclonal antibody. Lane 1: ARL11 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ARL11 antibody
May play a role in apoptosis. May act as a tumor suppressor.
Product Categories/Family for anti-ARL11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,391 Da
NCBI Official Full Name
ADP-ribosylation factor-like protein 11
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 11
NCBI Official Symbol
ARL11
NCBI Official Synonym Symbols
ARLTS1
NCBI Protein Information
ADP-ribosylation factor-like protein 11; ADP-ribosylation factor-like tumor suppressor protein 1
UniProt Protein Name
ADP-ribosylation factor-like protein 11
UniProt Gene Name
ARL11
UniProt Synonym Gene Names
ARLTS1
UniProt Entry Name
ARL11_HUMAN

NCBI Description

This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]

Uniprot Description

ARL11: May play a role in apoptosis. May act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL). Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; G protein, monomeric

Chromosomal Location of Human Ortholog: 13q14.2

Cellular Component: intracellular

Molecular Function: protein binding; GTP binding

Biological Process: small GTPase mediated signal transduction; hemopoietic progenitor cell differentiation

Disease: Leukemia, Chronic Lymphocytic

Research Articles on ARL11

Similar Products

Product Notes

The ARL11 arl11 (Catalog #AAA6370331) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARL11 (ADP-ribosylation Factor-like Protein 11, ADP-ribosylation Factor-like Tumor Suppressor Protein 1, ARLTS1, FLJ33930, MGC17429) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARL11 arl11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARL11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.