Western Blot (WB)
(WB Suggested Anti-APOL4 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Rabbit anti-Human APOL4 Polyclonal Antibody | anti-APOL4 antibody
APOL4 antibody - N-terminal region
Gene Names
APOL4; APOLIV; APOL-IV
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOL4; Polyclonal Antibody; APOL4 antibody - N-terminal region; anti-APOL4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELPREEADALYEALKNLTPYVAIEDKDMQQKEQQFREWFLKEFPQIRWKI
Sequence Length
348
Applicable Applications for anti-APOL4 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-APOL4 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Western Blot (WB)
(WB Suggested Anti-APOL4 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-APOL4 antibody
This is a rabbit polyclonal antibody against APOL4. It was validated on Western Blot
Target Description: The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein.
Target Description: The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein.
Product Categories/Family for anti-APOL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39kDa
NCBI Official Full Name
apolipoprotein L4 isoform 1
NCBI Official Synonym Full Names
apolipoprotein L4
NCBI Official Symbol
APOL4
NCBI Official Synonym Symbols
APOLIV; APOL-IV
NCBI Protein Information
apolipoprotein L4
UniProt Protein Name
APOL4 protein
Protein Family
UniProt Gene Name
APOL4
UniProt Entry Name
Q6ICI8_HUMAN
NCBI Description
The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq, Jul 2008]
Research Articles on APOL4
Similar Products
Product Notes
The APOL4 apol4 (Catalog #AAA3215084) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOL4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOL4 apol4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELPREEADAL YEALKNLTPY VAIEDKDMQQ KEQQFREWFL KEFPQIRWKI. It is sometimes possible for the material contained within the vial of "APOL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
