Western Blot (WB)
(WB Suggested Anti-ALS2CR11 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Rabbit anti-Human C2CD6 Polyclonal Antibody | anti-C2CD6 antibody
C2CD6 Antibody - N-terminal region
Gene Names
C2CD6; ALS2CR11
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C2CD6; Polyclonal Antibody; C2CD6 Antibody - N-terminal region; anti-C2CD6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPPQETNRPFSTLDNRSGQVQVLSATPLLQRNPYSSPDIMHIKGSEASSV
Sequence Length
395
Applicable Applications for anti-C2CD6 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ALS2CR11 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Western Blot (WB)
(WB Suggested Anti-ALS2CR11 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-C2CD6 antibody
This is a rabbit polyclonal antibody against ALS2CR11. It was validated on Western Blot
Target Description: An autosomal recessive form of juvenile amyotrophic lateral sclerosis was originally mapped to a region of chromosome 2 that includes this gene. The encoded protein contains a calcium-dependent membrane targeting C2 domain. This domain is often found in proteins that are involved in membrane trafficking and signal transduction.
Target Description: An autosomal recessive form of juvenile amyotrophic lateral sclerosis was originally mapped to a region of chromosome 2 that includes this gene. The encoded protein contains a calcium-dependent membrane targeting C2 domain. This domain is often found in proteins that are involved in membrane trafficking and signal transduction.
Product Categories/Family for anti-C2CD6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
C2 calcium-dependent domain-containing protein 6 isoform 4
NCBI Official Synonym Full Names
C2 calcium dependent domain containing 6
NCBI Official Symbol
C2CD6
NCBI Official Synonym Symbols
ALS2CR11
NCBI Protein Information
C2 calcium-dependent domain-containing protein 6
UniProt Protein Name
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 11 protein
UniProt Gene Name
ALS2CR11
UniProt Entry Name
AL2SA_HUMAN
NCBI Description
An autosomal recessive form of juvenile amyotrophic lateral sclerosis was originally mapped to a region of chromosome 2 that includes this gene. The encoded protein contains a calcium-dependent membrane targeting C2 domain. This domain is often found in proteins that are involved in membrane trafficking and signal transduction. [provided by RefSeq, Jun 2016]
Uniprot Description
ALS2CR11: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 2q33.1
Similar Products
Product Notes
The C2CD6 als2cr11 (Catalog #AAA3211092) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C2CD6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C2CD6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C2CD6 als2cr11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPPQETNRPF STLDNRSGQV QVLSATPLLQ RNPYSSPDIM HIKGSEASSV. It is sometimes possible for the material contained within the vial of "C2CD6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
