Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APOL1Sample Type: Human OVCAR-3Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

Rabbit anti-Human APOL1 Polyclonal Antibody | anti-APOL1 antibody

APOL1 antibody - N-terminal region

Gene Names
APOL1; APOL; APO-L; FSGS4; APOL-I
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOL1; Polyclonal Antibody; APOL1 antibody - N-terminal region; anti-APOL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLAR
Sequence Length
398
Applicable Applications for anti-APOL1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APOL1Sample Type: Human OVCAR-3Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

Western Blot (WB) (Host: RabbitTarget Name: APOL1Sample Type: Human OVCAR-3Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

Western Blot (WB)

(WB Suggested Anti-APOL1 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellAPOL1 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-APOL1 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellAPOL1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-APOL1 antibody
This is a rabbit polyclonal antibody against APOL1. It was validated on Western Blot

Target Description: This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-APOL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
apolipoprotein L1 isoform a
NCBI Official Synonym Full Names
apolipoprotein L1
NCBI Official Symbol
APOL1
NCBI Official Synonym Symbols
APOL; APO-L; FSGS4; APOL-I
NCBI Protein Information
apolipoprotein L1
UniProt Protein Name
Apolipoprotein L1
Protein Family
UniProt Gene Name
APOL1
UniProt Synonym Gene Names
APOL; Apo-L; ApoL; ApoL-I
UniProt Entry Name
APOL1_HUMAN

NCBI Description

This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008]

Uniprot Description

APOL1: May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver. Defects in APOL1 are the cause of focal segmental glomerulosclerosis type 4 (FSGS4). It is a renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. Belongs to the apolipoprotein L family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Channel, chloride; Lipid-binding

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: extracellular space; extracellular region; intrinsic to membrane

Molecular Function: protein binding; chloride channel activity; lipid binding

Biological Process: receptor-mediated endocytosis; cholesterol metabolic process; killing of cells of another organism; cytolysis; innate immune response; lipoprotein metabolic process; chloride transport; lipid transport

Disease: Focal Segmental Glomerulosclerosis 4, Susceptibility To

Research Articles on APOL1

Similar Products

Product Notes

The APOL1 apol1 (Catalog #AAA3214079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOL1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOL1 apol1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA AELPRNEADE LRKALDNLAR. It is sometimes possible for the material contained within the vial of "APOL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.