Western Blot (WB)
(Western Blot analysis of AP1M2 expression in transfected 293T cell line by AP1M2 polyclonal antibody. Lane 1: AP1M2 transfected lysate (46.53KD). Lane 2: Non-transfected lysate.)
Mouse anti-Human AP1M2 Polyclonal Antibody | anti-Ap1m2 antibody
AP1M2 (AP-1 Complex Subunit mu-2, AP-mu Chain Family Member mu1B, Adaptor Protein Complex AP-1 mu-2 Subunit, Adaptor-related Protein Complex 1 mu-2 Subunit, Clathrin Assembly Protein Complex 1 Medium Chain 2, Golgi Adaptor HA1/AP1 Adaptin mu-2 Subunit, Mu
Gene Names
Ap1m2; mu1B; [m]1B; D9Ertd818e
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
AP1M2; Polyclonal Antibody; AP1M2 (AP-1 Complex Subunit mu-2; AP-mu Chain Family Member mu1B; Adaptor Protein Complex AP-1 mu-2 Subunit; Adaptor-related Protein Complex 1 mu-2 Subunit; Clathrin Assembly Protein Complex 1 Medium Chain 2; Golgi Adaptor HA1/AP1 Adaptin mu-2 Subunit; Mu; Anti -AP1M2 (AP-1 Complex Subunit mu-2; anti-Ap1m2 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AP1M2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS
Applicable Applications for anti-Ap1m2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human AP1M2, aa1-423 (NP_005489).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of AP1M2 expression in transfected 293T cell line by AP1M2 polyclonal antibody. Lane 1: AP1M2 transfected lysate (46.53KD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of AP1M2 expression in transfected 293T cell line by AP1M2 polyclonal antibody. Lane 1: AP1M2 transfected lysate (46.53KD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-Ap1m2 antibody
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Product Categories/Family for anti-Ap1m2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,137 Da
NCBI Official Full Name
AP-1 complex subunit mu-2 isoform 2
NCBI Official Synonym Full Names
adaptor protein complex AP-1, mu 2 subunit
NCBI Official Symbol
Ap1m2
NCBI Official Synonym Symbols
mu1B; [m]1B; D9Ertd818e
NCBI Protein Information
AP-1 complex subunit mu-2; mu-adaptin 2; mu1B-adaptin; AP-mu chain family member mu1B; adaptor protein complex AP-1 mu-2 subunit; golgi adaptor HA1/AP1 adaptin mu-2 subunit; adaptor-related protein complex 1 mu-2 subunit; adaptor-related protein complex AP-1, mu 2 subunit; clathrin assembly protein complex 1 medium chain 2
UniProt Protein Name
AP-1 complex subunit mu-2
Protein Family
UniProt Gene Name
Ap1m2
UniProt Entry Name
AP1M2_MOUSE
Uniprot Description
Function: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Subunit structure: Adaptor protein complex 1 (AP-1) is a heterotetramer composed of two large adaptins (gamma-type subunit AP1G1 and beta-type subunit AP1B1), a medium adaptin (mu-type subunit AP1M1 or AP1M2) and a small adaptin (sigma-type subunit AP1S1 or AP1S2 or AP1S3). Ref.5
Subcellular location: Golgi apparatus. Cytoplasmic vesicle › clathrin-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Post-translational modification: Phosphorylation of membrane-bound AP1M1/AP1M2 increases its affinity for sorting signals
By similarity.
Sequence similarities: Belongs to the adaptor complexes medium subunit family.Contains 1 MHD (mu homology) domain.
Similar Products
Product Notes
The Ap1m2 ap1m2 (Catalog #AAA649959) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP1M2 (AP-1 Complex Subunit mu-2, AP-mu Chain Family Member mu1B, Adaptor Protein Complex AP-1 mu-2 Subunit, Adaptor-related Protein Complex 1 mu-2 Subunit, Clathrin Assembly Protein Complex 1 Medium Chain 2, Golgi Adaptor HA1/AP1 Adaptin mu-2 Subunit, Mu reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP1M2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Ap1m2 ap1m2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSASAVFILD VKGKPLISRN YKGDVAMSKI EHFMPLLVQR EEEGALAPLL SHGQVHFLWI KHSNLYLVAT TSKNANASLV YSFLYKTIEV FCEYFKELEE ESIRDNFVIV YELLDELMDF GFPQTTDSKI LQEYITQQSN KLETGKSRVP PTVTNAVSWR SEGIKYKKNE VFIDVIESVN LLVNANGSVL LSEIVGTIKL KVFLSGMPEL RLGLNDRVLF ELTGRSKNKS VELEDVKFHQ CVRLSRFDND RTISFIPPDG DFELMSYRLS TQVKPLIWIE SVIEKFSHSR VEIMVKAKGQ FKKQSVANGV EISVPVPSDA DSPRFKTSVG SAKYVPERNV VIWSIKSFPG GKEYLMRAHF GLPSVEKEEV EGRPPIGVKF EIPYFTVSGI QVRYMKIIEK SGYQALPWVR YITQSGDYQL RTS. It is sometimes possible for the material contained within the vial of "AP1M2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
