Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AP1S1 expression in transfected 293T cell line by AP1S1 polyclonal antibody. Lane 1: AP1S1 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human AP1S1 Polyclonal Antibody | anti-AP1S1 antibody

AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 A

Gene Names
AP1S1; AP19; CLAPS1; MEDNIK; SIGMA1A; WUGSC:H_DJ0747G18.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
AP1S1; Polyclonal Antibody; AP1S1 (AP-1 Complex Subunit sigma-1A; Adapter-related Protein Complex 1 sigma-1A Subunit; Adaptor Protein Complex AP-1 sigma-1A Subunit; Clathrin Assembly Protein Complex 1 sigma-1A Small Chain; Clathrin Coat Assembly Protein AP19; Golgi Adaptor HA1/AP1 A; Anti -AP1S1 (AP-1 Complex Subunit sigma-1A; anti-AP1S1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AP1S1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Applicable Applications for anti-AP1S1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human AP1S1, aa1-158 (NP_001274.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AP1S1 expression in transfected 293T cell line by AP1S1 polyclonal antibody. Lane 1: AP1S1 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AP1S1 expression in transfected 293T cell line by AP1S1 polyclonal antibody. Lane 1: AP1S1 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AP1S1 antibody
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Product Categories/Family for anti-AP1S1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,733 Da
NCBI Official Full Name
AP-1 complex subunit sigma-1A
NCBI Official Synonym Full Names
adaptor-related protein complex 1, sigma 1 subunit
NCBI Official Symbol
AP1S1
NCBI Official Synonym Symbols
AP19; CLAPS1; MEDNIK; SIGMA1A; WUGSC:H_DJ0747G18.2
NCBI Protein Information
AP-1 complex subunit sigma-1A; sigma1A-adaptin; HA1 19 kDa subunit; clathrin coat assembly protein AP19; golgi adaptor HA1/AP1 adaptin sigma-1A subunit; sigma1A subunit of AP-1 clathrin adaptor complex; adapter-related protein complex 1 sigma-1A subunit; clathrin assembly protein complex 1 sigma-1A small chain; clathrin-associated/assembly/adaptor protein, small 1 (19kD)
UniProt Protein Name
AP-1 complex subunit sigma-1A
Protein Family
UniProt Gene Name
AP1S1
UniProt Synonym Gene Names
AP19; CLAPS1
UniProt Entry Name
AP1S1_HUMAN

NCBI Description

The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq, Jul 2008]

Uniprot Description

AP1S1: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Belongs to the adaptor complexes small subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: Golgi membrane; cytoplasmic vesicle membrane; AP-1 adaptor complex; membrane; lysosomal membrane; trans-Golgi network membrane; coated pit; cytosol

Molecular Function: protein transporter activity

Biological Process: intracellular protein transport; receptor-mediated endocytosis; viral reproduction; response to virus; antigen processing and presentation of exogenous peptide antigen via MHC class II; post-Golgi vesicle-mediated transport; regulation of defense response to virus by virus

Disease: Mental Retardation, Enteropathy, Deafness, Peripheral Neuropathy, Ichthyosis, And Keratoderma

Research Articles on AP1S1

Similar Products

Product Notes

The AP1S1 ap1s1 (Catalog #AAA6004374) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 A reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP1S1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the AP1S1 ap1s1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMRFMLLFSR QGKLRLQKWY LATSDKERKK MVRELMQVVL ARKPKMCSFL EWRDLKVVYK RYASLYFCCA IEGQDNELIT LELIHRYVEL LDKYFGSVCE LDIIFNFEKA YFILDEFLMG GDVQDTSKKS VLKAIEQADL LQEEDESPRS VLEEMGLA. It is sometimes possible for the material contained within the vial of "AP1S1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.