Mouse anti-Human MXD1 Monoclonal Antibody | anti-MXD1 antibody

MXD1 (Max Dimerization Protein 1, Max Dimerizer 1, Protein MAD, MAD, MGC104659) (HRP)

Cat. Num. AAA6153647

• Gene Names: MXD1; MAD; MAD1; BHLHC58; MGC104659
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MXD1; Monoclonal Antibody; MXD1 (Max Dimerization Protein 1; Max Dimerizer 1; Protein MAD; MAD; MGC104659) (HRP); anti-MXD1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G10
• Specificity: Recognizes human MXD1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MXD1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 6ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa60-149 from human MXD1 (NP_002348) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to MXD1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 6ug/ml])

Product Categories/Family for anti-MXD1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4505069
• NCBI GeneID: 4084
• NCBI Accession #: NP_002348.1
• NCBI GenBank Nucleotide #: NM_002357
• UniProt Accession #: Q05195; Q6FI41; B2R6V8; D6W5G2
• Molecular Weight: 25,254 Da
• NCBI Official Full Name: max dimerization protein 1 isoform 1
• NCBI Official Synonym Full Names: MAX dimerization protein 1
• NCBI Official Symbol: MXD1
• NCBI Official Synonym Symbols: MAD; MAD1; BHLHC58; MGC104659
• NCBI Protein Information: max dimerization protein 1; max dimerizer 1; OTTHUMP00000160049; MAX-binding protein; antagonizer of myc transcriptional activity
• UniProt Protein Name: Max dimerization protein 1
• Protein Family: Max dimerization protein
• UniProt Gene Name: MXD1
• UniProt Synonym Gene Names: MAD; Max dimerizer 1
• UniProt Entry Name: MAD1_HUMAN

NCBI Description

This gene encodes a member of the MYC/MAX/MAD network of basic helix-loop-helix leucine zipper transcription factors. The MYC/MAX/MAD transcription factors mediate cellular proliferation, differentiation and apoptosis. The encoded protein antagonizes MYC-mediated transcriptional activation of target genes by competing for the binding partner MAX and recruiting repressor complexes containing histone deacetylases. Mutations in this gene may play a role in acute leukemia, and the encoded protein is a potential tumor suppressor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq]

Uniprot Description

Mad1: Transcriptional repressor. MAD binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MAD thus antagonizes MYC transcriptional activity by competing for MAX. Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with RNF17. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 2p13-p12

Cellular Component: nucleus

Molecular Function: protein dimerization activity; transcription cofactor activity; transcription corepressor activity; transcription factor activity

Biological Process: cell proliferation; transcription, DNA-dependent; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter