Testing Data
(Detection limit for recombinant GST tagged AP1S2 is ~3ng/ml as a capture antibody.)
Mouse anti-Human AP1S2 Monoclonal Antibody | anti-AP1S2 antibody
AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-1B Subunit, Sigma 1B Subu
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AP1S2; Monoclonal Antibody; AP1S2 (AP-1 Complex Subunit sigma-2; Adapter-related Protein Complex 1 sigma-1B Subunit; Adaptor Protein Complex AP-1 sigma-1B Subunit; Clathrin Assembly Protein Complex 1 sigma-1B Small Chain; Golgi Adaptor HA1/AP1 Adaptin sigma-1B Subunit; Sigma 1B Subu; anti-AP1S2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B9-G5
Specificity
Recognizes human AP1S2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-AP1S2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-158 from human AP1S2 (AAH01117) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged AP1S2 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged AP1S2 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-AP1S2 antibody
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Product Categories/Family for anti-AP1S2 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The AP1S2 (Catalog #AAA6156525) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-1B Subunit, Sigma 1B Subu reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP1S2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AP1S2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AP1S2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
